KEGG   Cricetulus griseus (Chinese hamster): 100689187Help
Entry
100689187         CDS       T02813                                 

Gene name
St3gal3
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00514  Other types of O-glycan biosynthesis
cge00515  Mannose type O-glycan biosynthesis
cge00533  Glycosaminoglycan biosynthesis - keratan sulfate
cge00601  Glycosphingolipid biosynthesis - lacto and neolacto series
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    100689187 (St3gal3)
   00514 Other types of O-glycan biosynthesis
    100689187 (St3gal3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    100689187 (St3gal3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100689187 (St3gal3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cge01003]
    100689187 (St3gal3)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     100689187 (St3gal3)
Glycosyltransferases [BR:cge01003]
 Terminal extension
  Sialyltransferase
   100689187 (St3gal3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 100689187
NCBI-ProteinID: XP_027254826
UniProt: G3HFG3
Position
2
AA seq 398 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLLLSLDSAGQTLGTEYDRLG
FLLKLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIR
EFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDY
DIVVRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKY
IVYKERVRGSFPFSGTHHQAPSSCLLMLCLQSASDGFWKSVATRVPKEPPEIRILNPYFI
QEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYE
TVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtatttgtgcgcaatctgctgctagccctctgcctcttcctggtcctg
ggatttttgtattattctgcttggaagttgcacttgctccaatgggaagactccaattca
ttgcttctttcccttgactccgctggacaaacactaggcacagagtatgatcggctgggc
tttctcctgaagctcgactctaaactgcctgccgagctagccacaaagtacgcaaacttt
tcagagggagcttgcaaacccggctacgcttcagccctgatgactgccatcttccccagg
ttctccaaaccagcacccatgttcctagatgactcctttcgaaagtgggctaggatccgg
gagtttgtgccaccttttggaatcaaaggtcaagacaacctgatcaaagccatcttgtca
gtcaccaaagagtaccgcctgacccctgccttggacagcctccactgccgccgctgcatc
attgtaggcaatggaggggtccttgccaacaagtctctggggtcacgaattgacgactat
gacattgtggtcagactgaattcagcacctgtgaagggctttgagagggacgtgggcagc
aagaccaccctgcgcatcacctatcctgagggtgctatgcagcggcctgagcagtatgaa
cgagactctctctttgtccttgctggcttcaaatggcaggacttcaagtggctgaagtac
atcgtctacaaggaaagagtgcgtgggtcctttccattcagcgggacacatcatcaggcg
cccagctcatgtcttcttatgctgtgtctacagagtgcatccgatggcttctggaagtct
gtggccactcgagtgcccaaggagcccccagagattcgcatcctcaatccatacttcatc
caggaggccgccttcactctcattggactgcccttcaacaatggcctcatgggcaggggg
aacatcccaacccttggcagtgtggcagtgaccatggcattacatggctgtgatgaagtg
gcagtcgcaggctttggctatgacatgaacacacccaatgcacccctacactactatgaa
actgtgcgcatggcagccatcaaagagtcctggacgcacaacatccagcgagaaaaggag
tttctacggaagctggtgaaagctcgcgtcatcactgacctaagcagtggcatctga

DBGET integrated database retrieval system