KEGG   Cricetulus griseus (Chinese hamster): 100689251Help
Entry
100689251         CDS       T02813                                 

Gene name
Pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00562  Inositol phosphate metabolism
cge01100  Metabolic pathways
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04070  Phosphatidylinositol signaling system
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05100  Bacterial invasion of epithelial cells
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05146  Amoebiasis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100689251 (Pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100689251 (Pik3ca)
   04015 Rap1 signaling pathway
    100689251 (Pik3ca)
   04012 ErbB signaling pathway
    100689251 (Pik3ca)
   04370 VEGF signaling pathway
    100689251 (Pik3ca)
   04630 Jak-STAT signaling pathway
    100689251 (Pik3ca)
   04668 TNF signaling pathway
    100689251 (Pik3ca)
   04066 HIF-1 signaling pathway
    100689251 (Pik3ca)
   04068 FoxO signaling pathway
    100689251 (Pik3ca)
   04070 Phosphatidylinositol signaling system
    100689251 (Pik3ca)
   04072 Phospholipase D signaling pathway
    100689251 (Pik3ca)
   04071 Sphingolipid signaling pathway
    100689251 (Pik3ca)
   04024 cAMP signaling pathway
    100689251 (Pik3ca)
   04151 PI3K-Akt signaling pathway
    100689251 (Pik3ca)
   04152 AMPK signaling pathway
    100689251 (Pik3ca)
   04150 mTOR signaling pathway
    100689251 (Pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100689251 (Pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    100689251 (Pik3ca)
   04218 Cellular senescence
    100689251 (Pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100689251 (Pik3ca)
   04550 Signaling pathways regulating pluripotency of stem cells
    100689251 (Pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100689251 (Pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100689251 (Pik3ca)
   04620 Toll-like receptor signaling pathway
    100689251 (Pik3ca)
   04625 C-type lectin receptor signaling pathway
    100689251 (Pik3ca)
   04650 Natural killer cell mediated cytotoxicity
    100689251 (Pik3ca)
   04660 T cell receptor signaling pathway
    100689251 (Pik3ca)
   04662 B cell receptor signaling pathway
    100689251 (Pik3ca)
   04664 Fc epsilon RI signaling pathway
    100689251 (Pik3ca)
   04666 Fc gamma R-mediated phagocytosis
    100689251 (Pik3ca)
   04670 Leukocyte transendothelial migration
    100689251 (Pik3ca)
   04062 Chemokine signaling pathway
    100689251 (Pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100689251 (Pik3ca)
   04923 Regulation of lipolysis in adipocytes
    100689251 (Pik3ca)
   04929 GnRH secretion
    100689251 (Pik3ca)
   04915 Estrogen signaling pathway
    100689251 (Pik3ca)
   04914 Progesterone-mediated oocyte maturation
    100689251 (Pik3ca)
   04917 Prolactin signaling pathway
    100689251 (Pik3ca)
   04926 Relaxin signaling pathway
    100689251 (Pik3ca)
   04935 Growth hormone synthesis, secretion and action
    100689251 (Pik3ca)
   04919 Thyroid hormone signaling pathway
    100689251 (Pik3ca)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100689251 (Pik3ca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100689251 (Pik3ca)
  09156 Nervous system
   04725 Cholinergic synapse
    100689251 (Pik3ca)
   04722 Neurotrophin signaling pathway
    100689251 (Pik3ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100689251 (Pik3ca)
  09158 Development and regeneration
   04360 Axon guidance
    100689251 (Pik3ca)
   04380 Osteoclast differentiation
    100689251 (Pik3ca)
  09149 Aging
   04211 Longevity regulating pathway
    100689251 (Pik3ca)
   04213 Longevity regulating pathway - multiple species
    100689251 (Pik3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100689251 (Pik3ca)
   05206 MicroRNAs in cancer
    100689251 (Pik3ca)
   05205 Proteoglycans in cancer
    100689251 (Pik3ca)
   05203 Viral carcinogenesis
    100689251 (Pik3ca)
   05230 Central carbon metabolism in cancer
    100689251 (Pik3ca)
   05231 Choline metabolism in cancer
    100689251 (Pik3ca)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100689251 (Pik3ca)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100689251 (Pik3ca)
   05212 Pancreatic cancer
    100689251 (Pik3ca)
   05225 Hepatocellular carcinoma
    100689251 (Pik3ca)
   05226 Gastric cancer
    100689251 (Pik3ca)
   05214 Glioma
    100689251 (Pik3ca)
   05221 Acute myeloid leukemia
    100689251 (Pik3ca)
   05220 Chronic myeloid leukemia
    100689251 (Pik3ca)
   05218 Melanoma
    100689251 (Pik3ca)
   05211 Renal cell carcinoma
    100689251 (Pik3ca)
   05215 Prostate cancer
    100689251 (Pik3ca)
   05213 Endometrial cancer
    100689251 (Pik3ca)
   05224 Breast cancer
    100689251 (Pik3ca)
   05222 Small cell lung cancer
    100689251 (Pik3ca)
   05223 Non-small cell lung cancer
    100689251 (Pik3ca)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100689251 (Pik3ca)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100689251 (Pik3ca)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100689251 (Pik3ca)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100689251 (Pik3ca)
   04931 Insulin resistance
    100689251 (Pik3ca)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100689251 (Pik3ca)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100689251 (Pik3ca)
   05100 Bacterial invasion of epithelial cells
    100689251 (Pik3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689251 (Pik3ca)
   05170 Human immunodeficiency virus 1 infection
    100689251 (Pik3ca)
   05162 Measles
    100689251 (Pik3ca)
   05164 Influenza A
    100689251 (Pik3ca)
   05161 Hepatitis B
    100689251 (Pik3ca)
   05160 Hepatitis C
    100689251 (Pik3ca)
   05168 Herpes simplex virus 1 infection
    100689251 (Pik3ca)
   05163 Human cytomegalovirus infection
    100689251 (Pik3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689251 (Pik3ca)
   05169 Epstein-Barr virus infection
    100689251 (Pik3ca)
   05165 Human papillomavirus infection
    100689251 (Pik3ca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100689251 (Pik3ca)
   05142 Chagas disease (American trypanosomiasis)
    100689251 (Pik3ca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100689251 (Pik3ca)
   01524 Platinum drug resistance
    100689251 (Pik3ca)
   01522 Endocrine resistance
    100689251 (Pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100689251 (Pik3ca)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100689251 (Pik3ca)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100689251 (Pik3ca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF4135 ASC
Motif
Other DBs
NCBI-GeneID: 100689251
NCBI-ProteinID: XP_027247822
Position
1
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
SFTMPSYSRRISTATPYMNGETTTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctccacgaccatcgtcgggtgaactgtggggcatccacttgatgcccccacgaatc
ctagtggaatgtttactcccaaatggaatgatagtgactttagaatgcctccgtgaggct
acactaatcaccataaaacacgaactgtttaaagaagccagaaaataccctctgcatcag
cttctgcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacggctttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgtt
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtccaggacttccga
aggaacattctgaatgtttgcaaagaagctgtggatctgcgggatctcaactcccctcat
agcagagcaatgtatgtctaccctcccaacgtagagtcttccccagaattgccaaagcac
atctacaacaagttagataaaggacaaatcatagtggtgatttgggtaattgtctctcca
aacaatgacaagcagaagtataccctgaagatcaaccacgactgtgtgccagagcaagtc
attgctgaagccatcaggaagaagactcggagcatgctgctctcgtctgagcagctgaaa
ctctgtgttttagaataccagggcaagtatattctgaaagtgtgtggctgtgatgaatac
ttcctagaaaaataccctctgagtcagtacaagtacataagaagctgtataatgctgggg
aggatgcccaacttgatgttgatggccaaagaaagcctttactctcagctgccaatggat
agcttcacaatgccgtcatactccaggcgcatctccacagccacgccctatatgaatgga
gagacaactacgaaatccctctgggttataaatagtgcgcttagaatcaaaattctttgt
gcaacttatgtaaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccacggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cctaggtggaatgaatggctgaattatgacatatacattcctgatcttcctcgcgctgct
cgcctttgcctttccatttgctctgttaaaggccgaaagggtgctaaggaggagcactgt
ccattggcctggggaaatataaacttgtttgattacacagacaccctagtatctgggaaa
atggctttgaatctctggcctgtaccacatgggttagaagatctgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccatgcttagagttggagtttgattggttc
agcagtgtggtgaagtttccagacatgtctgtgatcgaagagcatgctaattggtctgtg
tcccgagaagctggattcagttactctcatacaggactgagtaacagactcgccagagac
aatgaactaagagaaaatgacaaagaacagctccgagcactttgcacccgggacccactg
tctgaaatcactgaacaagagaaagatttcctatggagccacagacactactgtgtaact
attcctgaaatcctacccaaattgcttttgtctgtcaagtggaattccagagatgaagta
gcccagatgtactgcttagtcaaagattggcctccaatcaagcctgagcaggccatggag
cttctggactgtaattatccagatcctatggttcggagttttgccgttcggtgcttggaa
aaatacttaacagatgacaaactttctcagtacctcattcagcttgtccaggtcttaaaa
tatgaacaatatttggataacctgcttgtgagatttttactcaagaaagcgttgacaaat
caaaggattggccattttttcttttggcatttaaaatctgagatgcacaataagaccgtc
agtcaaaggtttggcctcctgttggagtcctactgccgtgcctgtgggatgtatctgaaa
cacctgaacagacaggtagaggccatggagaagctcatcaacctaactgacatcctcaaa
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttggttgagcagatgaga
cagccagatttcatggatgctctgcagggttttctgtctcctctaaaccctgctcatcag
ctagggaacctcagacttgaagagtgtcgaattatgtcctctgcaaaaagaccactgtgg
ttgaattgggagaacccagacatcatgtcagagctactgtttcagaacaatgagatcatc
tttaaaaatggcgatgatttacggcaagatatgttaacacttcagatcatccggattatg
gagaacatctggcaaaaccaaggccttgaccttcgaatgctaccttatggctgtctgtcc
attggggactgtgtggggctcatcgaagtggtgagaaactctcacactatcatgcagatc
cagtgcaaaggaggcctaaagggggcactgcagttcaacagtcacacactgcaccagtgg
ctcaaggacaagaataagggagaaatatatgatgcagccattgacctattcacaaggtca
tgtgctggctactgtgtggcaaccttcatcttggggattggagaccggcacaatagcaac
atcatggtgaaagatgatggacagctgtttcatatagattttgggcactttttggatcac
aagaagaagaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatatacaaagaccagagagtttgagagattt
caggagatgtgttacaaggcttacctagcaattcggcagcatgccaatctcttcatcaac
ctgttttcaatgatgcttggctctggaatgccggaactgcagtcttttgatgacattgca
tatattcgaaagactctggccttagacaaaactgagcaagaggctttggaatatttcaca
aaacaaatgaatgatgcacatcatggcggctggacgacaaaaatggattggatcttccac
accatcaagcagcatgcattgaactga

KEGG   Cricetulus griseus (Chinese hamster): 100689252Help
Entry
100689252         CDS       T02813                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X2
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00562  Inositol phosphate metabolism
cge01100  Metabolic pathways
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04070  Phosphatidylinositol signaling system
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05100  Bacterial invasion of epithelial cells
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05146  Amoebiasis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100689252 (Pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100689252 (Pik3cb)
   04015 Rap1 signaling pathway
    100689252 (Pik3cb)
   04012 ErbB signaling pathway
    100689252 (Pik3cb)
   04370 VEGF signaling pathway
    100689252 (Pik3cb)
   04630 Jak-STAT signaling pathway
    100689252 (Pik3cb)
   04668 TNF signaling pathway
    100689252 (Pik3cb)
   04066 HIF-1 signaling pathway
    100689252 (Pik3cb)
   04068 FoxO signaling pathway
    100689252 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    100689252 (Pik3cb)
   04072 Phospholipase D signaling pathway
    100689252 (Pik3cb)
   04071 Sphingolipid signaling pathway
    100689252 (Pik3cb)
   04024 cAMP signaling pathway
    100689252 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    100689252 (Pik3cb)
   04152 AMPK signaling pathway
    100689252 (Pik3cb)
   04150 mTOR signaling pathway
    100689252 (Pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100689252 (Pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    100689252 (Pik3cb)
   04218 Cellular senescence
    100689252 (Pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100689252 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    100689252 (Pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100689252 (Pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100689252 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    100689252 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    100689252 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    100689252 (Pik3cb)
   04660 T cell receptor signaling pathway
    100689252 (Pik3cb)
   04662 B cell receptor signaling pathway
    100689252 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    100689252 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    100689252 (Pik3cb)
   04670 Leukocyte transendothelial migration
    100689252 (Pik3cb)
   04062 Chemokine signaling pathway
    100689252 (Pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100689252 (Pik3cb)
   04923 Regulation of lipolysis in adipocytes
    100689252 (Pik3cb)
   04929 GnRH secretion
    100689252 (Pik3cb)
   04915 Estrogen signaling pathway
    100689252 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    100689252 (Pik3cb)
   04917 Prolactin signaling pathway
    100689252 (Pik3cb)
   04926 Relaxin signaling pathway
    100689252 (Pik3cb)
   04935 Growth hormone synthesis, secretion and action
    100689252 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    100689252 (Pik3cb)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100689252 (Pik3cb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100689252 (Pik3cb)
  09156 Nervous system
   04725 Cholinergic synapse
    100689252 (Pik3cb)
   04722 Neurotrophin signaling pathway
    100689252 (Pik3cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100689252 (Pik3cb)
  09158 Development and regeneration
   04360 Axon guidance
    100689252 (Pik3cb)
   04380 Osteoclast differentiation
    100689252 (Pik3cb)
  09149 Aging
   04211 Longevity regulating pathway
    100689252 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    100689252 (Pik3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100689252 (Pik3cb)
   05206 MicroRNAs in cancer
    100689252 (Pik3cb)
   05205 Proteoglycans in cancer
    100689252 (Pik3cb)
   05203 Viral carcinogenesis
    100689252 (Pik3cb)
   05230 Central carbon metabolism in cancer
    100689252 (Pik3cb)
   05231 Choline metabolism in cancer
    100689252 (Pik3cb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100689252 (Pik3cb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100689252 (Pik3cb)
   05212 Pancreatic cancer
    100689252 (Pik3cb)
   05225 Hepatocellular carcinoma
    100689252 (Pik3cb)
   05226 Gastric cancer
    100689252 (Pik3cb)
   05214 Glioma
    100689252 (Pik3cb)
   05221 Acute myeloid leukemia
    100689252 (Pik3cb)
   05220 Chronic myeloid leukemia
    100689252 (Pik3cb)
   05218 Melanoma
    100689252 (Pik3cb)
   05211 Renal cell carcinoma
    100689252 (Pik3cb)
   05215 Prostate cancer
    100689252 (Pik3cb)
   05213 Endometrial cancer
    100689252 (Pik3cb)
   05224 Breast cancer
    100689252 (Pik3cb)
   05222 Small cell lung cancer
    100689252 (Pik3cb)
   05223 Non-small cell lung cancer
    100689252 (Pik3cb)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100689252 (Pik3cb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100689252 (Pik3cb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100689252 (Pik3cb)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100689252 (Pik3cb)
   04931 Insulin resistance
    100689252 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100689252 (Pik3cb)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100689252 (Pik3cb)
   05100 Bacterial invasion of epithelial cells
    100689252 (Pik3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689252 (Pik3cb)
   05170 Human immunodeficiency virus 1 infection
    100689252 (Pik3cb)
   05162 Measles
    100689252 (Pik3cb)
   05164 Influenza A
    100689252 (Pik3cb)
   05161 Hepatitis B
    100689252 (Pik3cb)
   05160 Hepatitis C
    100689252 (Pik3cb)
   05168 Herpes simplex virus 1 infection
    100689252 (Pik3cb)
   05163 Human cytomegalovirus infection
    100689252 (Pik3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689252 (Pik3cb)
   05169 Epstein-Barr virus infection
    100689252 (Pik3cb)
   05165 Human papillomavirus infection
    100689252 (Pik3cb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100689252 (Pik3cb)
   05142 Chagas disease (American trypanosomiasis)
    100689252 (Pik3cb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100689252 (Pik3cb)
   01524 Platinum drug resistance
    100689252 (Pik3cb)
   01522 Endocrine resistance
    100689252 (Pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100689252 (Pik3cb)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100689252 (Pik3cb)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100689252 (Pik3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 DUF4381 Tom37_C DUF4135
Motif
Other DBs
NCBI-GeneID: 100689252
NCBI-ProteinID: XP_027270061
Position
4
AA seq 1078 aa AA seqDB search
MCFSSMMPPAMADILDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREATISYIKQMLW
KHVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEDKIQSLVGLSWIDWLKHTYPPEH
EASVLENLEDKLYGGKLIVAVHFENSQDVFSFQVSPNLTPIKINELAIQKRLTIHGNEDE
VSPYDCVLQVSGRVEYVFGEHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRVISVRSPSHTLHVWDNNNPFQIVLVKGNKLNTEETVKVH
VRAGLFHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVK
TKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEM
LNPMGTVQTNPYAENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANMSSRGGK
KFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQ
ALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFL
DCALSRFLLERALNNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQ
VEALNKLKTLNSLIKLNAMKLNRAKGKEAMHTCLRQNAYREALSGLQSPLNPCVILSELY
VEKCKYMDSKMKPLWLVYSNRGFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGL
DLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGD
DLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIK
RERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGL
PELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRRDYRS
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcagctctatgatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatcgcttctgatggcgccatatctgtggatttccttctgcccactgggatt
tatatccagttggaagtacctcgggaagctaccatttcttatattaaacagatgttatgg
aagcacgttcacaattacccaatgtttaacctccttatggacattgactcctacatgttt
gcatgtgtgaatcagactgctgtatatgaggaacttgaagatgaaactcggagactttgt
gatgtcagaccttttcttccagttctaaaactagtgactagaagttgtgacccagcagaa
aaattggactcaaaaattggagtccttataggaaaaggtcttcatgaatttgatgccttg
aaggatcctgaagtgaatgaatttagaagaaaaatgcgcaaattcagcgaggacaagatt
cagtccctagtggggttgtcttggattgactggctaaagcacacgtatccaccggagcat
gaggcatctgtcctggagaacttggaagataaactgtatggagggaagctgatcgtggct
gtgcattttgaaaatagccaggatgtatttagttttcaagtgtctcccaatttgacgcct
ataaaaataaatgaattggcaatccagaaacgcttgactattcacggaaatgaagatgaa
gttagcccctatgactgtgtgttacaagtcagtggcagagtggagtatgtatttggagaa
catccactaattcagttccagtatatccggaactgtgtaatgaataggaccctgccccat
ttcatccttgtggaatgttgcaagatcaagaagatgtatgagcaagaaatgattgccata
gaggctgccatcaaccgaaactcctccaaccttcctctccctttaccaccaaagaaaacg
cgagttatttctgtaagatccccgtctcacactttgcatgtctgggacaacaataaccct
ttccaaattgtcttggtgaaaggaaataagcttaacacagaagaaactgtgaaagttcac
gtcagagctggtctttttcatggaacagagctcctgtgtaaaaccgtcgtcagctcagaa
atatcaggaaaaaatgaccatatttggaatgaacaactggaatttgatattaatatttgt
gacttaccaagaatggctcgattatgttttgctgtttatgccgttttggataaagtaaaa
acaaagaaatcaacaaaaactattaatccctctaaatatcagaccatcaggaaagctggg
aaagtgcattatcctgtagcatgggtaaatacgatggtttttgacttcaaaggacagctg
aggtctggagacataatattgcacagctggtcttcgttccctgatgagctggaagaaatg
ctgaatccaatgggcactgtgcagacgaacccatatgctgaaaatgcaactgccttgcac
attaagtttccagagaataaaaagcagccttattattaccctcccttcgataagatcatt
gaaaaggcagctgagattgccagcagtgacagtgctaacatgtcaagtcgaggtggaaaa
aaatttcttgctgtactgaaagaaatcttggacagagaccccctgtctcaactgtgtgag
aatgaaatggatcttatttggactttgcggcaagactgccgagaaaatttcccacagtca
ctgccaaaactactcctgtcaatcaagtggaataaacttgaagatgttgctcagcttcag
gcactcctgcagatttggcccaaactgccacccagggaagccctggagctcctggatttc
aactacccagaccagtatgtccgggaatatgctgtaggttgcctgcgacagatgagtgat
gaagaactctctcagtatcttttacagttggtgcaagtgttgaaatatgagccttttctt
gattgtgccctctctagattcctattagaaagagcacttaataatcggaggattgggcag
tttctgttttggcatcttaggtcagaggtgcatattcccgccgtgtcggtacagttcggt
gtcatcctagaagcatactgtcgaggaagcgtagggcacatgaaagtgctttccaagcag
gttgaagcactcaataagttaaaaactttaaatagcttaatcaagttgaatgcgatgaag
ctcaaccgagcgaaagggaaggaggctatgcacacttgcttaagacagaatgcttaccgg
gaggccctctctggcctgcagtcacctctgaatccatgtgtcatcctctcagaactctat
gttgaaaagtgcaaatacatggactccaagatgaagcccttgtggctggtctacagcaac
agaggttttggagaggactcagttggagtgatctttaaaaacggtgacgatttgcggcag
gacatgctgacgctgcagatgctacgcctgatggatctgctctggaaagaggccggtttg
gaccttcggatgcttccctatggctgcttagcaacaggagatcgctctggcctcattgag
gttgttagcacctctgagacaatcgctgacattcagctgaacagtagcaacgtggctgcc
acagcagccttcaacaaagatgcactcctgaactggcttaaagagtacaattctggggat
gacctggaccgagcaattgaggagttcaccctgtcctgtgctggctactgtgtagcttct
tatgtccttggcattggtgacaggcatagtgacaacatcatggtgaaaaaaactggccag
ctcttccacatagattttggacatattctcgggaatttcaaatctaaattcggcattaaa
agagagcgagtaccttttattcttacttatgacttcattcatgtcattcaacaaggaaaa
acgggaaatacagaaaagtttggcaggtttcgccagtgctgtgaagatgcctatctgatt
ttacggcggcatgggaacctcttcatcaccctctttgcactgatgttgactgcagggctt
cccgaactcacatcagtcaaagatatacagtatcttaaggactctcttgccttaggaaag
agtgaagaagaagcactcaaacaatttaagcaaaagtttgacgaggcgctcagggaaagc
tggactaccaaggtgaactggatggctcacacagtccgcagagactacaggtcttag

KEGG   Cricetulus griseus (Chinese hamster): 100750761Help
Entry
100750761         CDS       T02813                                 

Gene name
Pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04070  Phosphatidylinositol signaling system
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05100  Bacterial invasion of epithelial cells
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05146  Amoebiasis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100750761 (Pik3r1)
   04015 Rap1 signaling pathway
    100750761 (Pik3r1)
   04012 ErbB signaling pathway
    100750761 (Pik3r1)
   04370 VEGF signaling pathway
    100750761 (Pik3r1)
   04630 Jak-STAT signaling pathway
    100750761 (Pik3r1)
   04668 TNF signaling pathway
    100750761 (Pik3r1)
   04066 HIF-1 signaling pathway
    100750761 (Pik3r1)
   04068 FoxO signaling pathway
    100750761 (Pik3r1)
   04070 Phosphatidylinositol signaling system
    100750761 (Pik3r1)
   04072 Phospholipase D signaling pathway
    100750761 (Pik3r1)
   04071 Sphingolipid signaling pathway
    100750761 (Pik3r1)
   04024 cAMP signaling pathway
    100750761 (Pik3r1)
   04151 PI3K-Akt signaling pathway
    100750761 (Pik3r1)
   04152 AMPK signaling pathway
    100750761 (Pik3r1)
   04150 mTOR signaling pathway
    100750761 (Pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100750761 (Pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    100750761 (Pik3r1)
   04218 Cellular senescence
    100750761 (Pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100750761 (Pik3r1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100750761 (Pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100750761 (Pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100750761 (Pik3r1)
   04620 Toll-like receptor signaling pathway
    100750761 (Pik3r1)
   04625 C-type lectin receptor signaling pathway
    100750761 (Pik3r1)
   04650 Natural killer cell mediated cytotoxicity
    100750761 (Pik3r1)
   04660 T cell receptor signaling pathway
    100750761 (Pik3r1)
   04662 B cell receptor signaling pathway
    100750761 (Pik3r1)
   04664 Fc epsilon RI signaling pathway
    100750761 (Pik3r1)
   04666 Fc gamma R-mediated phagocytosis
    100750761 (Pik3r1)
   04670 Leukocyte transendothelial migration
    100750761 (Pik3r1)
   04062 Chemokine signaling pathway
    100750761 (Pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100750761 (Pik3r1)
   04923 Regulation of lipolysis in adipocytes
    100750761 (Pik3r1)
   04929 GnRH secretion
    100750761 (Pik3r1)
   04915 Estrogen signaling pathway
    100750761 (Pik3r1)
   04914 Progesterone-mediated oocyte maturation
    100750761 (Pik3r1)
   04917 Prolactin signaling pathway
    100750761 (Pik3r1)
   04926 Relaxin signaling pathway
    100750761 (Pik3r1)
   04935 Growth hormone synthesis, secretion and action
    100750761 (Pik3r1)
   04919 Thyroid hormone signaling pathway
    100750761 (Pik3r1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100750761 (Pik3r1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100750761 (Pik3r1)
  09156 Nervous system
   04725 Cholinergic synapse
    100750761 (Pik3r1)
   04722 Neurotrophin signaling pathway
    100750761 (Pik3r1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100750761 (Pik3r1)
  09158 Development and regeneration
   04360 Axon guidance
    100750761 (Pik3r1)
   04380 Osteoclast differentiation
    100750761 (Pik3r1)
  09149 Aging
   04211 Longevity regulating pathway
    100750761 (Pik3r1)
   04213 Longevity regulating pathway - multiple species
    100750761 (Pik3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100750761 (Pik3r1)
   05206 MicroRNAs in cancer
    100750761 (Pik3r1)
   05205 Proteoglycans in cancer
    100750761 (Pik3r1)
   05203 Viral carcinogenesis
    100750761 (Pik3r1)
   05230 Central carbon metabolism in cancer
    100750761 (Pik3r1)
   05231 Choline metabolism in cancer
    100750761 (Pik3r1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100750761 (Pik3r1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100750761 (Pik3r1)
   05212 Pancreatic cancer
    100750761 (Pik3r1)
   05225 Hepatocellular carcinoma
    100750761 (Pik3r1)
   05226 Gastric cancer
    100750761 (Pik3r1)
   05214 Glioma
    100750761 (Pik3r1)
   05221 Acute myeloid leukemia
    100750761 (Pik3r1)
   05220 Chronic myeloid leukemia
    100750761 (Pik3r1)
   05218 Melanoma
    100750761 (Pik3r1)
   05211 Renal cell carcinoma
    100750761 (Pik3r1)
   05215 Prostate cancer
    100750761 (Pik3r1)
   05213 Endometrial cancer
    100750761 (Pik3r1)
   05224 Breast cancer
    100750761 (Pik3r1)
   05222 Small cell lung cancer
    100750761 (Pik3r1)
   05223 Non-small cell lung cancer
    100750761 (Pik3r1)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100750761 (Pik3r1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100750761 (Pik3r1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100750761 (Pik3r1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100750761 (Pik3r1)
   04931 Insulin resistance
    100750761 (Pik3r1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100750761 (Pik3r1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100750761 (Pik3r1)
   05100 Bacterial invasion of epithelial cells
    100750761 (Pik3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100750761 (Pik3r1)
   05170 Human immunodeficiency virus 1 infection
    100750761 (Pik3r1)
   05162 Measles
    100750761 (Pik3r1)
   05164 Influenza A
    100750761 (Pik3r1)
   05161 Hepatitis B
    100750761 (Pik3r1)
   05160 Hepatitis C
    100750761 (Pik3r1)
   05168 Herpes simplex virus 1 infection
    100750761 (Pik3r1)
   05163 Human cytomegalovirus infection
    100750761 (Pik3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100750761 (Pik3r1)
   05169 Epstein-Barr virus infection
    100750761 (Pik3r1)
   05165 Human papillomavirus infection
    100750761 (Pik3r1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100750761 (Pik3r1)
   05142 Chagas disease (American trypanosomiasis)
    100750761 (Pik3r1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100750761 (Pik3r1)
   01524 Platinum drug resistance
    100750761 (Pik3r1)
   01522 Endocrine resistance
    100750761 (Pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100750761 (Pik3r1)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100750761 (Pik3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I DUF4201 Lant_dehydr_C Mod_r PI_PP_I
Motif
Other DBs
NCBI-GeneID: 100750761
NCBI-ProteinID: XP_027257385
UniProt: G3H4N4
Position
2
AA seq 726 aa AA seqDB search
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQPGQYALTLPD
LAEQFAPPDVAPPLLIKLVDAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMI
DVQVLADAFKRYLLDLPNPVIPGAVYNEMSLAQEVQSPEDYIQLLKKLIRSPNIPHQYWL
TLQYLLKHFFKLSQASSKNLLNSRVLSEIFSPVLFRFPAASSDNTEHLIKVIEILISTEW
NERQPAPALPPKPPKTTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVR
DASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNP
KLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQ
MKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEI
IDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWL
GNENTEDQYSLVEDEEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYA
CSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
YAQQRR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgagggataccagtacagagcactgtatgactacaagaaggagagagaggag
gacatcgacctgcacttgggtgacatattaactgtgaataaagggtccttagtggcactt
ggattcagtgatggacaggaagcccggcctgaagatattggctggttaaatggctacaat
gaaaccaccggggagaggggagactttccaggaacatacgttgaatatattggaaggaaa
agaatttcacctcccactcccaagccccggcccccacgacctcttcctgttgcaccaggt
tcttcaaaaactgaagcagacacggagcaaccaggtcagtatgctttgacccttcccgat
ctggctgagcagttcgcccctcctgatgttgccccacctctccttatcaagctagtggac
gccattgagaagaaaggactggaatgttcgactctatacagaacacagagctccagcaac
cctgcagaattacgacagcttcttgattgtgatgccgcctcagtggacttggaaatgatt
gatgtacaagttttagcagatgctttcaaacgctatctcttggacttaccaaatcccgtc
attccaggagctgtttacaatgaaatgtctttagcccaagaagtacaaagccctgaagac
tatatccagctattgaagaagctcattaggtcacctaatatacctcatcagtattggctt
acgcttcagtatttgcttaaacatttcttcaagctctctcaagcctccagcaaaaatctt
ttgaattcaagagtactctctgagattttcagccctgtgctttttagattcccagcagcc
agctctgataatactgaacacctcataaaagtgatagagattttaatctcaactgaatgg
aatgagcgacagccagcaccagcactgccccctaaaccacccaagaccactactgtagcc
aacaacggcatgaacaacaatatgtccttacaggatgctgaatggtactggggagacatc
tcaagggaagaagtgaatgaaaaactccgagatacagctgacggcacctttttggtacga
gatgcatctactaaaatgcacggcgattatactcttacactaaggaaaggaggaaataac
aaattaatcaaaatatttcaccgagatggaaaatatggcttctctgatccattaaccttc
aactctgtggttgaactaataaaccactaccggaatgagtctctagctcagtataacccc
aagctggatgtgaagctgctctacccagtgtccaaataccagcaggatcaagttgtcaaa
gaagataatattgaagctgtagggaaaaaattacatgaatataatactcaatttcaagaa
aaaagtcgggaatatgatagattatatgaagaatacacccgtacttcccaggagattcag
atgaaaagaacagctatcgaagcatttaatgaaaccataaaaatatttgaagaacaatgc
cagacccaggagcggtacagcaaagaatacatagaaaagtttaaacgtgaaggcaacgag
aaagagattcaaaggattatgcataactatgataagctaaagtctcgaatcagtgagatc
attgacagtaggaggagattagaggaagacttgaagaagcaggcagccgaataccgcgag
attgacaagcgcatgaacagcattaagccagacctcattcagctgagaaagacaagagac
caatacttgatgtggctgacgcagaaaggtgttcggcagaagaagttgaacgagtggttg
ggaaacgaaaacactgaagaccaatactcactggtagaagatgaagaggacctgccccac
cacgatgaaaagacatggaatgttggcagcagcaatcgaaacaaagctgagaatctatta
cgggggaagcgagatggcacttttcttgtccgggagagcagtaagcagggctgctatgcc
tgctctgtagtggtagatggcgaagtcaagcattgcgtaatcaacaagactgccactggc
tatggctttgccgagccctacaacctgtacagctccctgaaggagctggtgctacattat
caacacacctccctcgtgcagcacaatgactccctcaatgtcacactagcatacccggta
tatgcacaacagaggcgatga

KEGG   Cricetulus griseus (Chinese hamster): 100769225Help
Entry
100769225         CDS       T02813                                 

Gene name
Pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X5
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00562  Inositol phosphate metabolism
cge01100  Metabolic pathways
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04070  Phosphatidylinositol signaling system
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05100  Bacterial invasion of epithelial cells
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05146  Amoebiasis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100769225 (Pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100769225 (Pik3cd)
   04015 Rap1 signaling pathway
    100769225 (Pik3cd)
   04012 ErbB signaling pathway
    100769225 (Pik3cd)
   04370 VEGF signaling pathway
    100769225 (Pik3cd)
   04630 Jak-STAT signaling pathway
    100769225 (Pik3cd)
   04668 TNF signaling pathway
    100769225 (Pik3cd)
   04066 HIF-1 signaling pathway
    100769225 (Pik3cd)
   04068 FoxO signaling pathway
    100769225 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    100769225 (Pik3cd)
   04072 Phospholipase D signaling pathway
    100769225 (Pik3cd)
   04071 Sphingolipid signaling pathway
    100769225 (Pik3cd)
   04024 cAMP signaling pathway
    100769225 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    100769225 (Pik3cd)
   04152 AMPK signaling pathway
    100769225 (Pik3cd)
   04150 mTOR signaling pathway
    100769225 (Pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100769225 (Pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    100769225 (Pik3cd)
   04218 Cellular senescence
    100769225 (Pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100769225 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    100769225 (Pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100769225 (Pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100769225 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    100769225 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    100769225 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    100769225 (Pik3cd)
   04660 T cell receptor signaling pathway
    100769225 (Pik3cd)
   04662 B cell receptor signaling pathway
    100769225 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    100769225 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    100769225 (Pik3cd)
   04670 Leukocyte transendothelial migration
    100769225 (Pik3cd)
   04062 Chemokine signaling pathway
    100769225 (Pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100769225 (Pik3cd)
   04923 Regulation of lipolysis in adipocytes
    100769225 (Pik3cd)
   04929 GnRH secretion
    100769225 (Pik3cd)
   04915 Estrogen signaling pathway
    100769225 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    100769225 (Pik3cd)
   04917 Prolactin signaling pathway
    100769225 (Pik3cd)
   04926 Relaxin signaling pathway
    100769225 (Pik3cd)
   04935 Growth hormone synthesis, secretion and action
    100769225 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    100769225 (Pik3cd)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100769225 (Pik3cd)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100769225 (Pik3cd)
  09156 Nervous system
   04725 Cholinergic synapse
    100769225 (Pik3cd)
   04722 Neurotrophin signaling pathway
    100769225 (Pik3cd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100769225 (Pik3cd)
  09158 Development and regeneration
   04360 Axon guidance
    100769225 (Pik3cd)
   04380 Osteoclast differentiation
    100769225 (Pik3cd)
  09149 Aging
   04211 Longevity regulating pathway
    100769225 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    100769225 (Pik3cd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769225 (Pik3cd)
   05206 MicroRNAs in cancer
    100769225 (Pik3cd)
   05205 Proteoglycans in cancer
    100769225 (Pik3cd)
   05203 Viral carcinogenesis
    100769225 (Pik3cd)
   05230 Central carbon metabolism in cancer
    100769225 (Pik3cd)
   05231 Choline metabolism in cancer
    100769225 (Pik3cd)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100769225 (Pik3cd)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100769225 (Pik3cd)
   05212 Pancreatic cancer
    100769225 (Pik3cd)
   05225 Hepatocellular carcinoma
    100769225 (Pik3cd)
   05226 Gastric cancer
    100769225 (Pik3cd)
   05214 Glioma
    100769225 (Pik3cd)
   05221 Acute myeloid leukemia
    100769225 (Pik3cd)
   05220 Chronic myeloid leukemia
    100769225 (Pik3cd)
   05218 Melanoma
    100769225 (Pik3cd)
   05211 Renal cell carcinoma
    100769225 (Pik3cd)
   05215 Prostate cancer
    100769225 (Pik3cd)
   05213 Endometrial cancer
    100769225 (Pik3cd)
   05224 Breast cancer
    100769225 (Pik3cd)
   05222 Small cell lung cancer
    100769225 (Pik3cd)
   05223 Non-small cell lung cancer
    100769225 (Pik3cd)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100769225 (Pik3cd)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100769225 (Pik3cd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100769225 (Pik3cd)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100769225 (Pik3cd)
   04931 Insulin resistance
    100769225 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100769225 (Pik3cd)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100769225 (Pik3cd)
   05100 Bacterial invasion of epithelial cells
    100769225 (Pik3cd)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100769225 (Pik3cd)
   05170 Human immunodeficiency virus 1 infection
    100769225 (Pik3cd)
   05162 Measles
    100769225 (Pik3cd)
   05164 Influenza A
    100769225 (Pik3cd)
   05161 Hepatitis B
    100769225 (Pik3cd)
   05160 Hepatitis C
    100769225 (Pik3cd)
   05168 Herpes simplex virus 1 infection
    100769225 (Pik3cd)
   05163 Human cytomegalovirus infection
    100769225 (Pik3cd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100769225 (Pik3cd)
   05169 Epstein-Barr virus infection
    100769225 (Pik3cd)
   05165 Human papillomavirus infection
    100769225 (Pik3cd)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100769225 (Pik3cd)
   05142 Chagas disease (American trypanosomiasis)
    100769225 (Pik3cd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100769225 (Pik3cd)
   01524 Platinum drug resistance
    100769225 (Pik3cd)
   01522 Endocrine resistance
    100769225 (Pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100769225 (Pik3cd)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100769225 (Pik3cd)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100769225 (Pik3cd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 100769225
NCBI-ProteinID: XP_027254071
Position
2
AA seq 1048 aa AA seqDB search
MPPGVDCPMEFWTKEESQSVAVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLRDPEVDDFRTKMRQFCEEVAAHRQQLGWEDWLQYSFPLQLEPSARSWRA
GILRVTNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVEQPEDYA
LQVNGRHEYLYGNYPLCQFQYICSCLHSGLTPHLTMVHASSILAMRDEQSNPAPPVQKPR
TKPPPIPAKKPSSVSLWSLEQPFCIELMEGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWRQRLEFDINICDLPRMARLCFALYAVVEKAKKARSTKKKSRKADCPIAW
ANLMLFDYKDQLKTGERRLYMWPSVPDEKGELLNPAGTVRSNPNTESAAALVIFLPEVAP
HPVYFPALEKILELGRHGEQRGRITEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQ
EHFPEALARLLLVTKWNKHEDVAQLSQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFA
IKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMH
VPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMH
MCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGSVGI
IFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIAN
IQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHS
DNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERF
RGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKQFR
VKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggagttctggaccaaagaagagagccagagcgtg
gctgttgacttcttgctgcccacaggggtctacctgaacttcccggtgtcccgaaatgcc
aacctcagcaccatcaagcaggtgctctggcatcgcgcacagtatgagcctctcttccac
atgctcagtgaccctgaggcttatgtgttcacctgtgtgaaccagacagccgagcagcag
gagctggaggatgagcagcggaggctgtgtgacatccagcccttcctgccggtgctgcgc
ctggtggcccgggagggtgaccgggtgaagaagcttgtcaactcccagatcagccttctc
attggcaaaggtctccatgagtttgattccctgcgggacccagaggtggatgacttccgc
actaagatgcgccagttttgcgaggaggtcgctgctcaccgccagcagctgggctgggag
gactggctgcagtatagcttccccctgcagctggagccctcggcacggagttggcgggct
ggcatactgcgtgtcaccaaccgagccctgctggttaatgtgaagttcgagggcagtgag
gagagcttcaccttccaggtatccaccaaggacatgcccctggcactgatggcctgtgcc
ctccgaaagaaggccacggtgttccggcagcctctggtggagcagcctgaagactatgcc
cttcaggtgaacgggaggcatgagtacctctatggcaactatccactctgccagtttcag
tacatctgcagctgcctgcacagcggactgacccctcacctgaccatggtccatgcctcc
tccatccttgccatgcgggatgagcagagcaaccctgcccccccagtccagaaaccacgc
accaaacctcccccaatccctgctaagaagccatcctctgtgtccctgtggtccctagag
cagccgttctgcattgagctgatggagggcagcaaggtgaatgccgatgagcggatgaag
ctggttgtgcaggccgggctcttccatggcaatgagatgctgtgcaagaccgtgtccagc
tcagaggtgaatgtgtgctcagagcccgtctggagacagcggctggagtttgacattaac
atctgtgacctgccgcgcatggctcggctctgctttgcgctctatgctgtggtggagaag
gctaagaaggcgcgttccacaaagaagaaatccaggaaggcggactgtcccattgcctgg
gccaacctcatgctgttcgactacaaggaccagctcaagactggggaacgccgtctctac
atgtggccctctgtcccagatgagaagggagagctgttgaaccctgcgggtacagtgcgc
agtaaccccaacacggagagtgccgcggccctggtcatcttcctgcctgaggtggctccc
caccctgtgtacttccctgctctggagaagatcctggagctggggcgtcacggggagcag
cgtggccgcatcacagaggaggagcagctgcagctgcgtgagatcctggagcggcggggg
tctggggagctgtacgaacacgagaaggacctggtgtggaaaatgcgtcacgaagtccag
gaacacttcccagaagcactggcccgcctgctgctggtcaccaagtggaataaacacgag
gatgtggcccagctatcccagatgctctatttgctgtgctcctggcccgagctgcctgtg
ctgagcgccctggaactgctggactttagcttccccgactgctacgtgggctccttcgcc
atcaagtccctgcggaagctgacggatgatgagcttttccagtaccttctgcagcttgtg
caggtgctcaaatacgagtcctacctggactgcgagttgaccaaattcttgttggatcga
gccctggctaaccgcaagatcggccacttcctcttctggcacctccgctctgagatgcat
gtaccgtccgtggccctgcgttttggcctcatcatggaggcctactgcagaggcagcaca
caccacatgaaggtgctgatgaagcagggggaagcactgagcaagcttaaggcactgaat
gactttgtgaaggtgagctctcagaagaccaccaagccccaaaccaaggagatgatgcat
atgtgcatgcgccaggagacctacatggaggccctgtcccacctgcagtctccgctggac
cccagcaccctgctggaggaagtctgtgtggagcagtgcaccttcatggactccaagatg
aagccactgtggatcatgtacagcagcgaggaggcgggcagtgctggcagcgtgggcatc
atctttaagaatggcgacgacctccgccaggacatgctgactctgcagatgatacagctg
atggacgtcctgtggaagcaggagggcctggacctgaggatgaccccctatggctgcctc
cccactggagaccgcacgggcctcattgaggtggtcctccactcggacaccattgccaac
atccagctaaacaagagcaacatggcggccacggctgctttcaacaaggacgccctgctc
aactggctcaagtccaagaaccccggggaggccctggatcgagccatcgaggagttcacc
ctctcctgtgctggctactgtgtggccacatacgtgctgggcattggtgaccgacatagt
gacaacatcatgatccgggagagtgggcagctgttccacattgattttggccactttctg
gggaacttcaagaccaagtttggaatcaaccgtgagcgagttcccttcattctcacctat
gactttgtccacgtgattcagcaggggaagaccaataacagtgagaaatttgaacggttc
cgtggctactgtgaacgagcctacaccatcctacggcgccatgggctgctcttcctccat
ctctttgccctgatgcgtgctgcaggtctgcctgagcttagctgctccaaagacatccag
tatctcaaggattctctggcgctagggaagacagaggaggaggcgctcaaacagttccgg
gtgaagttcaatgaagccctacgggagagctggaaaaccaaagtcaactggctggcacac
aacgtgtccaaggataacaggcaataa

KEGG   Cricetulus griseus (Chinese hamster): 100771181Help
Entry
100771181         CDS       T02813                                 

Gene name
Pik3r2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta isoform X2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04070  Phosphatidylinositol signaling system
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05100  Bacterial invasion of epithelial cells
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05146  Amoebiasis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100771181 (Pik3r2)
   04015 Rap1 signaling pathway
    100771181 (Pik3r2)
   04012 ErbB signaling pathway
    100771181 (Pik3r2)
   04370 VEGF signaling pathway
    100771181 (Pik3r2)
   04630 Jak-STAT signaling pathway
    100771181 (Pik3r2)
   04668 TNF signaling pathway
    100771181 (Pik3r2)
   04066 HIF-1 signaling pathway
    100771181 (Pik3r2)
   04068 FoxO signaling pathway
    100771181 (Pik3r2)
   04070 Phosphatidylinositol signaling system
    100771181 (Pik3r2)
   04072 Phospholipase D signaling pathway
    100771181 (Pik3r2)
   04071 Sphingolipid signaling pathway
    100771181 (Pik3r2)
   04024 cAMP signaling pathway
    100771181 (Pik3r2)
   04151 PI3K-Akt signaling pathway
    100771181 (Pik3r2)
   04152 AMPK signaling pathway
    100771181 (Pik3r2)
   04150 mTOR signaling pathway
    100771181 (Pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100771181 (Pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    100771181 (Pik3r2)
   04218 Cellular senescence
    100771181 (Pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100771181 (Pik3r2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100771181 (Pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100771181 (Pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100771181 (Pik3r2)
   04620 Toll-like receptor signaling pathway
    100771181 (Pik3r2)
   04625 C-type lectin receptor signaling pathway
    100771181 (Pik3r2)
   04650 Natural killer cell mediated cytotoxicity
    100771181 (Pik3r2)
   04660 T cell receptor signaling pathway
    100771181 (Pik3r2)
   04662 B cell receptor signaling pathway
    100771181 (Pik3r2)
   04664 Fc epsilon RI signaling pathway
    100771181 (Pik3r2)
   04666 Fc gamma R-mediated phagocytosis
    100771181 (Pik3r2)
   04670 Leukocyte transendothelial migration
    100771181 (Pik3r2)
   04062 Chemokine signaling pathway
    100771181 (Pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100771181 (Pik3r2)
   04923 Regulation of lipolysis in adipocytes
    100771181 (Pik3r2)
   04929 GnRH secretion
    100771181 (Pik3r2)
   04915 Estrogen signaling pathway
    100771181 (Pik3r2)
   04914 Progesterone-mediated oocyte maturation
    100771181 (Pik3r2)
   04917 Prolactin signaling pathway
    100771181 (Pik3r2)
   04926 Relaxin signaling pathway
    100771181 (Pik3r2)
   04935 Growth hormone synthesis, secretion and action
    100771181 (Pik3r2)
   04919 Thyroid hormone signaling pathway
    100771181 (Pik3r2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100771181 (Pik3r2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100771181 (Pik3r2)
  09156 Nervous system
   04725 Cholinergic synapse
    100771181 (Pik3r2)
   04722 Neurotrophin signaling pathway
    100771181 (Pik3r2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100771181 (Pik3r2)
  09158 Development and regeneration
   04360 Axon guidance
    100771181 (Pik3r2)
   04380 Osteoclast differentiation
    100771181 (Pik3r2)
  09149 Aging
   04211 Longevity regulating pathway
    100771181 (Pik3r2)
   04213 Longevity regulating pathway - multiple species
    100771181 (Pik3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100771181 (Pik3r2)
   05206 MicroRNAs in cancer
    100771181 (Pik3r2)
   05205 Proteoglycans in cancer
    100771181 (Pik3r2)
   05203 Viral carcinogenesis
    100771181 (Pik3r2)
   05230 Central carbon metabolism in cancer
    100771181 (Pik3r2)
   05231 Choline metabolism in cancer
    100771181 (Pik3r2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100771181 (Pik3r2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100771181 (Pik3r2)
   05212 Pancreatic cancer
    100771181 (Pik3r2)
   05225 Hepatocellular carcinoma
    100771181 (Pik3r2)
   05226 Gastric cancer
    100771181 (Pik3r2)
   05214 Glioma
    100771181 (Pik3r2)
   05221 Acute myeloid leukemia
    100771181 (Pik3r2)
   05220 Chronic myeloid leukemia
    100771181 (Pik3r2)
   05218 Melanoma
    100771181 (Pik3r2)
   05211 Renal cell carcinoma
    100771181 (Pik3r2)
   05215 Prostate cancer
    100771181 (Pik3r2)
   05213 Endometrial cancer
    100771181 (Pik3r2)
   05224 Breast cancer
    100771181 (Pik3r2)
   05222 Small cell lung cancer
    100771181 (Pik3r2)
   05223 Non-small cell lung cancer
    100771181 (Pik3r2)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100771181 (Pik3r2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100771181 (Pik3r2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100771181 (Pik3r2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100771181 (Pik3r2)
   04931 Insulin resistance
    100771181 (Pik3r2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100771181 (Pik3r2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100771181 (Pik3r2)
   05100 Bacterial invasion of epithelial cells
    100771181 (Pik3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100771181 (Pik3r2)
   05170 Human immunodeficiency virus 1 infection
    100771181 (Pik3r2)
   05162 Measles
    100771181 (Pik3r2)
   05164 Influenza A
    100771181 (Pik3r2)
   05161 Hepatitis B
    100771181 (Pik3r2)
   05160 Hepatitis C
    100771181 (Pik3r2)
   05168 Herpes simplex virus 1 infection
    100771181 (Pik3r2)
   05163 Human cytomegalovirus infection
    100771181 (Pik3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100771181 (Pik3r2)
   05169 Epstein-Barr virus infection
    100771181 (Pik3r2)
   05165 Human papillomavirus infection
    100771181 (Pik3r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100771181 (Pik3r2)
   05142 Chagas disease (American trypanosomiasis)
    100771181 (Pik3r2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100771181 (Pik3r2)
   01524 Platinum drug resistance
    100771181 (Pik3r2)
   01522 Endocrine resistance
    100771181 (Pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100771181 (Pik3r2)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100771181 (Pik3r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 Ribosomal_L22e Tai4 ATG11
Motif
Other DBs
NCBI-GeneID: 100771181
NCBI-ProteinID: XP_027250539
Position
1
AA seq 721 aa AA seqDB search
MAGSEGFQYRAVYPFRRERPEDLELLPGDLLVVSRVALQALGVADGGERCPHNVGWMPGF
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPLDGPSESGLTLADLAEQFSP
PDPAPPILVKLVEAIEQAGLDSECYSRPELPAPRTDWSLSDVEQWDRNALYDAVKGFLLA
LPTPVVTPEAAAEAHRALREAAGPVGPVLEPPMLPLHHALTLRFLLQHLGRVARRAPVQA
TAVHSLASAFGPLLLRTPPPGGDTDGSEPGPGFPVLLLERLLQEHVDEQDAAPPALPPKP
SKAKPAPTALANGGNPPSLQDAEWYWGDISREEVNERLRDTPDGTFLVRDASSKIQGEYT
LTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHYRHESLAQYNAKLDTRLLYPVS
KYQQDQVVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNE
TIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQDL
RAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQRKINEWLGIKNETEDQYS
LMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTK
HCVIYRTATGFGFAEPYNLYASLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPTA
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagtgagggcttccagtacagggctgtgtacccattccgccgggagcggcct
gaggacctggagctactgcctggagacctactggtggtgagccgtgtggctctgcaggca
ctgggcgtggcagatggaggggagcgctgtccacacaacgtgggctggatgcctggcttc
aatgagcgcacccggcagcgaggggacttccctggaacgtatgtggagttcctagggcct
gtggctctggctcgaccaggacctcgcccacgaggcccccgtccattgcccgccaggccc
ttggatgggccctctgagtcaggcctcacactggcagacctggcagagcagttctcccca
cctgaccctgctccgcccattctggtgaagctggtagaggccattgagcaagcagggctg
gacagtgaatgctatagtcggccggagctgcccgcacctcggacagactggtccctgagt
gatgtggagcagtgggatcgaaacgccttgtacgatgctgttaagggcttcctgctggcg
ctgcctacacctgtggtgactcctgaggctgcagcagaggcacaccgggcactgcgggag
gctgcagggcccgtggggccagtgctggaacccccaatgctgccactgcaccatgcgctc
acactgcggttcctgctgcagcacctgggccgtgtggcccgcagagcacctgtgcaggcc
acagctgtccactcgctggccagcgcctttgggccgctcctactgcgcacacctccgcca
gggggtgacactgatgggagtgagcctgggccaggcttcccagtgctgctgttggagagg
ctgctgcaggaacacgtggatgagcaggatgccgcccccccagcactgccacccaaaccc
tctaaggcaaagccggcccccacagctctggctaatggagggaacccgccctcgcttcag
gatgcagagtggtactggggggacatctccagggaagaggtgaatgagagactccgggac
acgcccgatggcacattcttggtccgagatgcatccagcaagatccaaggagagtacacg
ctcaccctcaggaaaggcgggaacaacaagctgatcaaagtcttccaccgggatggccac
tacggcttctccgagcccctcaccttctgctccgtggtggagctcatttcccactaccgc
cacgagtcgctggcccagtacaacgccaagctggacacacgcctgctctaccctgtgtcc
aagtaccagcaggaccaggtggtgaaggaggacagtgtggaggctgtgggtgcccagctc
aaggtctaccaccagcagtaccaggacaagagccgcgaatacgatcagctgtatgaggaa
tacacacggacctcccaggagcttcagatgaagcgcacagccatagaggccttcaatgag
accatcaagatcttcgaagaacagggccagacgcaggaaaagtgcagcaaggagtatttg
gagcgcttccggcgagagggcaatgagaaggagatgcagaggatcttgctaaactctgag
cggctcaagtcacgcatcgcagaaatccatgagagccgcacaaaactggaacaggacctg
cgggcgcaggcctcggacaaccgtgagatcgacaagcgcatgaacagcctcaagccggac
ctcatgcagctgcgcaagatccgggaccagtacctcgtgtggctcacccagaaaggtgcc
cgacagaggaagatcaacgagtggctggggatcaagaacgagactgaggaccagtattca
ctgatggaggatgaggacgccctcccccaccacgaggagcgcacgtggtacgtgggcaag
atcaaccgcacacaggcagaggagatgctgagtggcaaacgggacgggaccttcctcatc
cgggagagcagccagcgaggctgttacgcatgctccgtggtggtggatggcgacaccaag
cactgtgtcatctaccgcacggccacaggcttcggcttcgcggagccctacaacctgtac
gcgtcactgaaggagctggtgctgcactaccagcacgcctccctcgtgcagcacaatgat
gcgctcacggtcaccctcgcgcaccctgtgcgcgcccccgggcctggcccacccacggcc
cgctga

KEGG   Cricetulus griseus (Chinese hamster): 100774067Help
Entry
100774067         CDS       T02813                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04070  Phosphatidylinositol signaling system
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04670  Leukocyte transendothelial migration
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05100  Bacterial invasion of epithelial cells
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05146  Amoebiasis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100774067
   04015 Rap1 signaling pathway
    100774067
   04012 ErbB signaling pathway
    100774067
   04370 VEGF signaling pathway
    100774067
   04630 Jak-STAT signaling pathway
    100774067
   04668 TNF signaling pathway
    100774067
   04066 HIF-1 signaling pathway
    100774067
   04068 FoxO signaling pathway
    100774067
   04070 Phosphatidylinositol signaling system
    100774067
   04072 Phospholipase D signaling pathway
    100774067
   04071 Sphingolipid signaling pathway
    100774067
   04024 cAMP signaling pathway
    100774067
   04151 PI3K-Akt signaling pathway
    100774067
   04152 AMPK signaling pathway
    100774067
   04150 mTOR signaling pathway
    100774067
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100774067
  09143 Cell growth and death
   04210 Apoptosis
    100774067
   04218 Cellular senescence
    100774067
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100774067
   04550 Signaling pathways regulating pluripotency of stem cells
    100774067
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100774067
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100774067
   04620 Toll-like receptor signaling pathway
    100774067
   04625 C-type lectin receptor signaling pathway
    100774067
   04650 Natural killer cell mediated cytotoxicity
    100774067
   04660 T cell receptor signaling pathway
    100774067
   04662 B cell receptor signaling pathway
    100774067
   04664 Fc epsilon RI signaling pathway
    100774067
   04666 Fc gamma R-mediated phagocytosis
    100774067
   04670 Leukocyte transendothelial migration
    100774067
   04062 Chemokine signaling pathway
    100774067
  09152 Endocrine system
   04910 Insulin signaling pathway
    100774067
   04923 Regulation of lipolysis in adipocytes
    100774067
   04929 GnRH secretion
    100774067
   04915 Estrogen signaling pathway
    100774067
   04914 Progesterone-mediated oocyte maturation
    100774067
   04917 Prolactin signaling pathway
    100774067
   04926 Relaxin signaling pathway
    100774067
   04935 Growth hormone synthesis, secretion and action
    100774067
   04919 Thyroid hormone signaling pathway
    100774067
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100774067
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100774067
  09156 Nervous system
   04725 Cholinergic synapse
    100774067
   04722 Neurotrophin signaling pathway
    100774067
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100774067
  09158 Development and regeneration
   04360 Axon guidance
    100774067
   04380 Osteoclast differentiation
    100774067
  09149 Aging
   04211 Longevity regulating pathway
    100774067
   04213 Longevity regulating pathway - multiple species
    100774067
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100774067
   05206 MicroRNAs in cancer
    100774067
   05205 Proteoglycans in cancer
    100774067
   05203 Viral carcinogenesis
    100774067
   05230 Central carbon metabolism in cancer
    100774067
   05231 Choline metabolism in cancer
    100774067
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100774067
  09162 Cancer: specific types
   05210 Colorectal cancer
    100774067
   05212 Pancreatic cancer
    100774067
   05225 Hepatocellular carcinoma
    100774067
   05226 Gastric cancer
    100774067
   05214 Glioma
    100774067
   05221 Acute myeloid leukemia
    100774067
   05220 Chronic myeloid leukemia
    100774067
   05218 Melanoma
    100774067
   05211 Renal cell carcinoma
    100774067
   05215 Prostate cancer
    100774067
   05213 Endometrial cancer
    100774067
   05224 Breast cancer
    100774067
   05222 Small cell lung cancer
    100774067
   05223 Non-small cell lung cancer
    100774067
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100774067
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100774067
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100774067
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100774067
   04931 Insulin resistance
    100774067
   04933 AGE-RAGE signaling pathway in diabetic complications
    100774067
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100774067
   05100 Bacterial invasion of epithelial cells
    100774067
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100774067
   05170 Human immunodeficiency virus 1 infection
    100774067
   05162 Measles
    100774067
   05164 Influenza A
    100774067
   05161 Hepatitis B
    100774067
   05160 Hepatitis C
    100774067
   05168 Herpes simplex virus 1 infection
    100774067
   05163 Human cytomegalovirus infection
    100774067
   05167 Kaposi sarcoma-associated herpesvirus infection
    100774067
   05169 Epstein-Barr virus infection
    100774067
   05165 Human papillomavirus infection
    100774067
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100774067
   05142 Chagas disease (American trypanosomiasis)
    100774067
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100774067
   01524 Platinum drug resistance
    100774067
   01522 Endocrine resistance
    100774067
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100774067
Membrane trafficking [BR:cge04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100774067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_P85_iSH2 SH2 Bap31_Bap29_C Transcrip_act Fez1 Mod_r
Motif
Other DBs
NCBI-GeneID: 100774067
NCBI-ProteinID: XP_027258349
UniProt: G3GYN9
Position
2
AA seq 460 aa AA seqDB search
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGVKDSFISL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKLQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKN
LQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKVRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDAESYFINEEDENLPHYDEKTWFVE
DVNRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNL
YSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttacaaatggagtgaaggacagtttcatttctctt
caagatgcagaatggtactggggagatatttccagggaagaggtaaatgacaaattacgg
gacatgccagatggtaccttcttagttcgtgatgcctcaacaaaattgcagggggactac
acgttgactcttaggaagggaggaaataataagttaataaagatctatcatcgggatggt
aaatacggcttttctgatcccctgacatttaattctgtggtggaactcattaaccattat
caccatgaatctcttgctcagtacaatcccaaactcgatgtgaagctgatgtacccagta
tccagataccaacaggatcagttggtaaaagaagataacattgatgcagtaggtaaaaac
ttgcaggagttccactctcagtatcaggagaagagtaaagaatatgacaggctgtatgaa
gagtacaccaggacatctcaggaaatacagatgaagaggactgcaattgaagcctttaat
gaaactattaaaatatttgaggagcagtgtcatacccaagaacaacacagtaaagaatat
attgagcgttttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattat
gataagttgaaatcacgtcttggtgagattcatgatagcaaagtgcgcctggagcaggac
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaatagcatcaaacct
gacctgatccagctgcgtaagattcgggatcagcaccttgtatggctcaatcacaaagga
gtgaggcagaagcgcctgaatgcctggctggggatcaagaacgaggatgctgaaagctat
tttattaatgaagaagatgagaatctgccacattatgatgaaaaaacctggtttgtggaa
gatgtcaaccgagtacaagcagaggacttgctttatgggaaaccagatggtgcattctta
attcgtgaaagtagcaagaaaggatgctatgcttgttctgtggtcgcggacggggaagtg
aagcactgtgtgatctacagcacggctcgaggatacggctttgcagaaccctacaacctg
tacagctcgctgaaggagctggtgctccattaccagcagacatccctggttcagcacaat
gactccctcaacgtcaggctcgcctaccctgtccatgcacagatgccctcactctgcaga
taa

DBGET integrated database retrieval system