KEGG   Cricetulus griseus (Chinese hamster): 100689282Help
Entry
100689282         CDS       T02813                                 

Gene name
Nat2
Definition
(RefSeq) arylamine N-acetyltransferase 2
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00232  Caffeine metabolism
cge00983  Drug metabolism - other enzymes
cge01100  Metabolic pathways
cge05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100689282 (Nat2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100689282 (Nat2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100689282 (Nat2)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100689282 (Nat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 Imm26
Motif
Other DBs
NCBI-GeneID: 100689282
NCBI-ProteinID: NP_001231342
UniProt: Q921C9
AA seq 290 aa AA seqDB search
MDIDAYFERIGYQNSRNKLDLQTLTEILQHQIQTIPFENLNIHCGESMELGLETIFDQIV
KKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVFNTPANKYSSGMIHLLVQVTISDRNYI
VDAGFGRSLQMWEPLELASGKDQPQVPAIFRLTEENETWYLDQIRREQYVPNQEFVNSDL
LEKNKYRKIYSFTLEPRTIEDFESINAYLQTSPASVFTSKSFCSLQTPEGVHCLVGCTLT
YRKFSYKDNVDLVEFKSLKEEEIEDVLKTIFGISLEKKLVPKHGDRFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgacgcgtactttgaaaggattggttatcagaattccaggaacaaactggac
ttgcaaacattaactgaaatccttcagcaccagatacaaactattccctttgagaacttg
aacatccattgtggggaatccatggagctgggcttagagactatctttgatcaaattgtg
aagaagaagaggggtgggtggtgtcttcaggttaatcatctcctgtactgggctctgaca
aaaatgggctttgaaaccacaatgttgggagggtatgtctttaacactccagctaataag
tatagcagtggtatgattcaccttctagtacaggtgaccatcagtgacaggaactacatt
gttgatgctggatttggacgttccctccagatgtgggagcctctggagttagcctcaggg
aaggaccagcctcaagtgcctgccatcttccgtttgacagaagagaatgaaacctggtac
ttggaccaaatcagaagagaacaatatgttccaaaccaagaatttgttaactcagacctc
cttgagaagaacaaatacagaaagatctattcttttactcttgaaccccgtactattgag
gactttgagtccatcaatgcctaccttcagacatcaccagcatccgtgtttacaagcaaa
tcattttgttctttgcagaccccagaaggggttcactgtttagtgggctgcaccctcacc
tataggaaattcagttataaggacaatgtagatcttgtggagtttaagagtctgaaggag
gaagaaatagaagatgtactcaaaactatatttggcatttctttagagaaaaaacttgtg
cccaagcatggtgataggttttttaccatttag

DBGET integrated database retrieval system