KEGG   Cricetulus griseus (Chinese hamster): 100689317Help
Entry
100689317         CDS       T02813                                 

Gene name
Soat1
Definition
(RefSeq) sterol O-acyltransferase 1
  KO
K00637  sterol O-acyltransferase [EC:2.3.1.26]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00100  Steroid biosynthesis
cge04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100689317 (Soat1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    100689317 (Soat1)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.26  sterol O-acyltransferase
     100689317 (Soat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-GeneID: 100689317
NCBI-ProteinID: NP_001233679
UniProt: Q60457
AA seq 546 aa AA seqDB search
MVGEEKMSLRNRLSKSGENPEQDEAQRSVSDTQSNGRITMKQLIAKKRQLAAEAEELKPL
FLKEVGCHFDDFVTNLIEKSASLDNGGCALTTFSILEEMKNNHRAKDLRAPPEKGKIFIS
RRSLLDELFEVDHIRTIYHMFIGLLILFILSTLVVDYIDEGRLVLEFNLLGYAFGKLPTV
IWTWWAMFLSTLSIPYFLFQRWAHGYSKTSHPLIYSLSHGFFFLVFQLGILGFVPTYVVL
AYTLPPASRFIVILEQIRMVMKAHSFVRENVPRVLNAAKEKSSTVPVPTVNQYLYFLFAP
TLIYRDSYPRTPTVRWGYVAVQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVL
CVFNSILPGVLMLFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVV
HDWLYYYAYKDLLWFFSKRFKSAAMLAVFALSAVVHEYALAVCLSYFYPVLFVLFMFFGM
AFNFIVNDSRKRPIWNIMVWASLFLGHGVILCFYSQEWYARQHCPLKNPTFLDYVRPRSW
TCQYVF
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggtgggagaagaaaagatgtcactaaggaaccggctgtcaaaatctggtgaaaatcct
gagcaagatgaagcccagagaagtgtctcagatacacagagcaatggtcgcattaccatg
aaacagttgatagccaagaagaggcagttggctgcagaggcagaggaattgaagccactg
tttctgaaggaagttggttgtcactttgatgactttgtgactaatctcattgaaaagtct
gcatctctggacaatggtgggtgtgctctcacaaccttctccattcttgaagaaatgaaa
aacaaccacagagccaaagatctgagagcacctccagaaaaagggaagatttttatttca
aggcggtctctgttagatgagctgtttgaagtggaccacatcagaactatttaccacatg
ttcattggactcctcatcctctttatcctcagcacacttgtggtagattacattgatgaa
ggaaggctggtacttgagttcaatctcttgggctatgcttttgggaaacttcctactgtt
atttggacatggtgggccatgttcctgtctacactttcaattccctatttcttgttccaa
cgttgggcccatggctacagcaagacttctcatccactcatctattcccttagccacggc
tttttcttcttagtcttccagcttggaattctaggttttgtaccaacgtatgttgtgtta
gcatacacactgcccccagcctcacggttcattgttatacttgaacagattcgtatggta
atgaaggctcactcgtttgtcagagagaatgtacctagagtactaaatgccgccaaggaa
aaatcaagcacagttccagtacccacagtcaaccagtacctgtacttcctgtttgctcct
acacttatttaccgtgacagctatccgaggactcctactgtaagatggggctatgttgct
gtccagtttttacaggtttttggctgtctgttttatgtgtactacatctttgagagactc
tgtgccccattgttccggaatatcaaacaggagcccttcagcgctcgtgttctggtcctg
tgtgtgtttaactccatcttgccaggtgtactgatgctgttccttacgttctttgccttt
ttgcactgctggctcaatgcctttgctgagatgctacgctttggtgacaggatgttttat
aaggactggtggaactctacatcctactccaactactacaggacctggaatgtggtggtc
catgattggctctactattatgcttacaaggacctcctctggtttttctcgaagaggttc
aaatctgccgccatgttggctgtcttcgccttgtcagctgtagtgcatgaatacgccctc
gctgtctgcttgagctatttctacccagtgctctttgtactcttcatgttctttggaatg
gcttttaactttattgttaacgacagccggaaaaggccaatatggaacattatggtatgg
gcttctctctttctgggccatggagtcattctgtgcttttattctcaagaatggtatgcc
cgccagcactgtcctctgaaaaatcccacctttctggattatgtccggccacgttcctgg
acttgtcagtacgtgttttag

DBGET integrated database retrieval system