KEGG   Cricetulus griseus (Chinese hamster): 100689472Help
Entry
100689472         CDS       T02813                                 

Gene name
Hspa8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03040  Spliceosome
cge04010  MAPK signaling pathway
cge04141  Protein processing in endoplasmic reticulum
cge04144  Endocytosis
cge04213  Longevity regulating pathway - multiple species
cge04612  Antigen processing and presentation
cge04915  Estrogen signaling pathway
cge05134  Legionellosis
cge05145  Toxoplasmosis
cge05162  Measles
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100689472 (Hspa8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100689472 (Hspa8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100689472 (Hspa8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100689472 (Hspa8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100689472 (Hspa8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100689472 (Hspa8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100689472 (Hspa8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100689472 (Hspa8)
  09172 Infectious disease: viral
   05162 Measles
    100689472 (Hspa8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100689472 (Hspa8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100689472 (Hspa8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cge03041]
    100689472 (Hspa8)
   03009 Ribosome biogenesis [BR:cge03009]
    100689472 (Hspa8)
   03110 Chaperones and folding catalysts [BR:cge03110]
    100689472 (Hspa8)
   04131 Membrane trafficking [BR:cge04131]
    100689472 (Hspa8)
   03051 Proteasome [BR:cge03051]
    100689472 (Hspa8)
   03029 Mitochondrial biogenesis [BR:cge03029]
    100689472 (Hspa8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100689472 (Hspa8)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100689472 (Hspa8)
Spliceosome [BR:cge03041]
 Complex B
  Other components
   Prp19 complex
    100689472 (Hspa8)
 Complex C
   Prp19-CDC5 complex
    100689472 (Hspa8)
Ribosome biogenesis [BR:cge03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100689472 (Hspa8)
Chaperones and folding catalysts [BR:cge03110]
 Heat shock proteins
  HSP70 / DNAK
   100689472 (Hspa8)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100689472 (Hspa8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100689472 (Hspa8)
Proteasome [BR:cge03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100689472 (Hspa8)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100689472 (Hspa8)
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100689472 (Hspa8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA
Motif
Other DBs
NCBI-GeneID: 100689472
NCBI-ProteinID: NP_001233658
UniProt: P19378
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGEAKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRNDKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggtattgatcttggcaccacctactcctgtgtgggtgtc
ttccagcatggaaaggtggagataattgccaatgaccagggtaaccgaaccacgccaagc
tatgttgcttttactgacacagaacgattaattggggatgccgcgaagaatcaggttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgatcggacgtaggtttgatgat
gctgttgttcagtctgatatgaagcactggcccttcatggtggtgaacgatgcaggcagg
cccaaggtccaagtagaatacaaaggagaggcaaaaagtttctacccagaggaggtgtcc
tctatggttctgaccaagatgaaggaaattgcagaagcctatctcgggaagactgttacc
aatgctgtggtcacagtgccagcctacttcaatgattctcagcgacaggctacaaaagat
gctggaactattgctggcctgaatgtcctgcgaattatcaatgaaccaactgctgctgct
attgcttatgggctagataagaaggttggagctgaaaggaatgtgctcatttttgacttg
ggaggtggtacttttgatgtgtctatcctcactattgaggatggaatttttgaagtcaaa
tcaacagccggagacacccacttgggtggagaagactttgataacagaatggtcaaccat
ttcattgctgagtttaagcgaaacgacaagaaggacatcagcgagaacaagagagctgtc
aggcgtctgcgtactgcctgtgaacgggcaaagcgcaccctctcctccagcacccaggcc
agtattgagattgattctctctatgagggaattgatttctatacctccattacccgtgct
cgattcgaagaattgaatgctgacctgttccgaggcactctggaccctgtagagaaggcc
cttcgagatgctaaactagacaagtcacagatccatgacattgtcttggtgggtggttcc
accagaatccccaagattcagaagcttctgcaagacttcttcaatggaaaagaactgaat
aagagcattaaccccgatgaagctgttgcttatggtgcagctgtccaggcggccattcta
tctggagacaagtctgagaatgttcaggatttgttgctcttggatgtcactcctctttcc
cttggcattgaaactgctggtggagtcatgactgtcctcatcaagcgcaataccaccatc
cctaccaagcagacgcagactttcactacctattctgacaatcagcctggtgtgctcatt
caggtctatgaaggcgaaagggccatgaccaaggataacaacctgcttggaaagtttgaa
cttacaggcatccctccagcaccccgtggtgttcctcagattgaagttacttttgacatt
gatgccaatggcatcctcaatgtctctgctgtagataagagcacaggcaaggagaacaag
atcactatcaccaacgacaagggccgcttgagcaaggaggatattgaacgcatggtccag
gaagctgagaagtacaaagctgaagatgagaagcagagagataaggtttcctccaagaat
tcactggagtcctatgctttcaacatgaaagcaacagttgaagacgagaaacttcaaggc
aagatcaatgatgaggacaaacagaagattctagacaagtgtaatgaaatcatcagttgg
ctggataagaatcagactgcagagaaggaagaatttgaacaccagcagaaagaactggag
aaagtctgcaaccccatcattaccaagctgtaccagagtgctggtggcatgcctggagga
atgcccgggggcttccctggtggtggagctcctccatctggtggtgcttcttcagggcct
accattgaagaggtggattaa

KEGG   Cricetulus griseus (Chinese hamster): 100760218Help
Entry
100760218         CDS       T02813                                 

Definition
(RefSeq) heat shock 70 kDa protein 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03040  Spliceosome
cge04010  MAPK signaling pathway
cge04141  Protein processing in endoplasmic reticulum
cge04144  Endocytosis
cge04213  Longevity regulating pathway - multiple species
cge04612  Antigen processing and presentation
cge04915  Estrogen signaling pathway
cge05134  Legionellosis
cge05145  Toxoplasmosis
cge05162  Measles
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100760218
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100760218
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100760218
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100760218
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100760218
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100760218
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100760218
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100760218
  09172 Infectious disease: viral
   05162 Measles
    100760218
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100760218
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100760218
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cge03041]
    100760218
   03009 Ribosome biogenesis [BR:cge03009]
    100760218
   03110 Chaperones and folding catalysts [BR:cge03110]
    100760218
   04131 Membrane trafficking [BR:cge04131]
    100760218
   03051 Proteasome [BR:cge03051]
    100760218
   03029 Mitochondrial biogenesis [BR:cge03029]
    100760218
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100760218
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100760218
Spliceosome [BR:cge03041]
 Complex B
  Other components
   Prp19 complex
    100760218
 Complex C
   Prp19-CDC5 complex
    100760218
Ribosome biogenesis [BR:cge03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100760218
Chaperones and folding catalysts [BR:cge03110]
 Heat shock proteins
  HSP70 / DNAK
   100760218
Membrane trafficking [BR:cge04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100760218
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100760218
Proteasome [BR:cge03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100760218
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100760218
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100760218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 100760218
NCBI-ProteinID: XP_027244609
UniProt: G3HZE5
Position
1
AA seq 641 aa AA seqDB search
MAKSTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDAVVQADMKHWPFQVVNDGDKPKVQVSYKGETRAFYPEEIS
SMVLTKMKEVAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRSGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRERVAAKN
ALESYAFNMKSAVEDEGLKGKISEADRKKVLDGCQEVISWLDANTLADKEEFVHKRQELE
RVCGPIVSGLYQGAGAPGAGGFGAQAPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccaagagcacggcgatcggcatcgacctgggcaccacctactcgtgcgtgggcgtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacccccagc
tacgtggccttcaccgacaccgagcggctgatcggagacgccgccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgcgaagcggctgatcggccgcaagttcggcgac
gcggtggtgcaggcggacatgaagcactggcccttccaggtggtgaacgacggcgacaag
cccaaggtgcaggtgagctacaagggcgagacgcgggccttctaccccgaggagatctcg
tccatggtgctgacgaagatgaaggaggtcgccgaggcgtacctgggccacccggtgacc
aacgcggtgatcacggtgcccgcctacttcaacgactcgcagcggcaggccaccaaggac
gcgggcgtgatcgcgggtctgaacgtgctgcggatcatcaacgagcccacggcggccgcc
atcgcctacgggctggaccgctcgggcaagggcgagcgcaacgtgctcatcttcgacctg
gggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggcgggggacacccacctgggcggcgaggacttcgacaaccggctggtgagccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgcgcggtg
cggcggctgcgcacggcctgcgagcgcgccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcacgcgggcg
cggttcgaggagctgtgctcggacctgttccgcggcacgctggagcccgtggagaaggcg
ctgcgcgacgccaagctggacaaggcgcagatccacgacctggtgctggtgggcggctcc
acgcgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctcaac
aagagcatcaacccggacgaggcggtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtctgagaacgtgcaggacctgctgctgctggacgtggcgccgctgtcg
ctgggtctggagacggcgggcggcgtgatgacggcgctcatcaagcgcaactccaccatc
cccaccaagcagacgcagaccttcaccacctactcggacaaccagcccggcgtgctgatc
caggtgtacgagggcgagcgggccatgacgcgcgacaacaacctgctgggccgcttcgag
ctcagcggcatcccgccggcgcccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccaccgacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccggctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagaggtacaaggccgaggacgaggtgcagcgcgagagggtggcggccaagaac
gcgctcgagtcctacgccttcaacatgaagagcgccgtggaggacgagggcctcaagggc
aagatcagcgaggccgacaggaagaaggtgctggacgggtgtcaggaggtcatctcctgg
ctggacgccaacacgctggccgacaaggaggagttcgtgcacaagcggcaggagctggag
agggtgtgcggccccatcgtcagcgggctctaccagggtgcgggtgctcccggggcgggc
ggcttcggggcccaggcgcccaagggaggctccgggtcgggacccaccatcgaggaggtg
gattag

KEGG   Cricetulus griseus (Chinese hamster): 100760510Help
Entry
100760510         CDS       T02813                                 

Gene name
Hspa1a
Definition
(RefSeq) heat shock 70 kDa protein 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03040  Spliceosome
cge04010  MAPK signaling pathway
cge04141  Protein processing in endoplasmic reticulum
cge04144  Endocytosis
cge04213  Longevity regulating pathway - multiple species
cge04612  Antigen processing and presentation
cge04915  Estrogen signaling pathway
cge05134  Legionellosis
cge05145  Toxoplasmosis
cge05162  Measles
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100760510 (Hspa1a)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100760510 (Hspa1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100760510 (Hspa1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100760510 (Hspa1a)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100760510 (Hspa1a)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100760510 (Hspa1a)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100760510 (Hspa1a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100760510 (Hspa1a)
  09172 Infectious disease: viral
   05162 Measles
    100760510 (Hspa1a)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100760510 (Hspa1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100760510 (Hspa1a)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cge03041]
    100760510 (Hspa1a)
   03009 Ribosome biogenesis [BR:cge03009]
    100760510 (Hspa1a)
   03110 Chaperones and folding catalysts [BR:cge03110]
    100760510 (Hspa1a)
   04131 Membrane trafficking [BR:cge04131]
    100760510 (Hspa1a)
   03051 Proteasome [BR:cge03051]
    100760510 (Hspa1a)
   03029 Mitochondrial biogenesis [BR:cge03029]
    100760510 (Hspa1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100760510 (Hspa1a)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100760510 (Hspa1a)
Spliceosome [BR:cge03041]
 Complex B
  Other components
   Prp19 complex
    100760510 (Hspa1a)
 Complex C
   Prp19-CDC5 complex
    100760510 (Hspa1a)
Ribosome biogenesis [BR:cge03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100760510 (Hspa1a)
Chaperones and folding catalysts [BR:cge03110]
 Heat shock proteins
  HSP70 / DNAK
   100760510 (Hspa1a)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100760510 (Hspa1a)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100760510 (Hspa1a)
Proteasome [BR:cge03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100760510 (Hspa1a)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100760510 (Hspa1a)
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100760510 (Hspa1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 100760510
NCBI-ProteinID: XP_027244616
UniProt: G3HZE6
Position
1
AA seq 641 aa AA seqDB search
MAKSTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDAVVQADMKHWPFQVVNDGDKPKVQVSYKGETRAFYPEEIS
SMVLTKMKEVAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRSGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRERVAAKN
ALESYAFNMKSAVEDEGLKGKISEADRKKVLDGCQEVISWLDANTLADKEEFVHKRQELE
RVCGPIVSGLYQGAGAPGAGGFGAQAPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccaagagcacggcgatcggcatcgacctgggcaccacctactcgtgcgtgggcgtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacccccagc
tacgtggccttcaccgacaccgagcggctgatcggagacgccgccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgcgaagcggctgatcggccgcaagttcggcgac
gcggtggtgcaggcggacatgaagcactggcccttccaggtggtgaacgacggcgacaag
cccaaggtgcaggtgagctacaagggcgagacgcgggccttctaccccgaggagatctcg
tccatggtgctgacgaagatgaaggaggtcgccgaggcgtacctgggccacccggtgacc
aacgcggtgatcacggtgcccgcctacttcaacgactcgcagcggcaggccaccaaggac
gcgggcgtgatcgcgggtctgaacgtgctgcggatcatcaacgagcccacggcggccgcc
atcgcctacgggctggaccgctcgggcaagggcgagcgcaacgtgctcatcttcgacctg
gggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggcgggggacacccacctgggcggcgaggacttcgacaaccggctggtgagccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgcgcggtg
cggcggctgcgcacggcctgcgagcgcgccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcacgcgggcg
cggttcgaggagctgtgctcggacctgttccgcggcacgctggagcccgtggagaaggcg
ctgcgcgacgccaagctggacaaggcgcagatccacgacctggtgctggtgggcggctcc
acgcgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctcaac
aagagcatcaacccggacgaggcggtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtctgagaacgtgcaggacctgctgctgctggacgtggcgccgctgtcg
ctgggtctggagacggcgggcggcgtgatgacggcgctcatcaagcgcaactccaccatc
cccaccaagcagacgcagaccttcaccacctactcggacaaccagcccggcgtgctgatc
caggtgtacgagggcgagcgggccatgacgcgcgacaacaacctgctgggccgcttcgag
ctcagcggcatcccgccggcgcccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccaccgacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccggctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagaggtacaaggccgaggacgaggtgcagcgcgagagggtggcggccaagaac
gcgctcgagtcctacgccttcaacatgaagagcgccgtggaggacgagggcctcaagggc
aagatcagcgaggccgacaggaagaaggtgctggacgggtgtcaggaggtcatctcctgg
ctggacgccaacacgctggccgacaaggaggagttcgtgcacaagcggcaggagctggag
agggtgtgcggccccatcgtcagcgggctctaccagggtgcgggtgctcccggggcgggc
ggcttcggggcccaggcgcccaagggaggctccgggtcggggcccaccatcgaggaggtg
gattag

KEGG   Cricetulus griseus (Chinese hamster): 100760804Help
Entry
100760804         CDS       T02813                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03040  Spliceosome
cge04010  MAPK signaling pathway
cge04141  Protein processing in endoplasmic reticulum
cge04144  Endocytosis
cge04213  Longevity regulating pathway - multiple species
cge04612  Antigen processing and presentation
cge04915  Estrogen signaling pathway
cge05134  Legionellosis
cge05145  Toxoplasmosis
cge05162  Measles
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100760804
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100760804
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100760804
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100760804
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100760804
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100760804
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100760804
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100760804
  09172 Infectious disease: viral
   05162 Measles
    100760804
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100760804
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100760804
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cge03041]
    100760804
   03009 Ribosome biogenesis [BR:cge03009]
    100760804
   03110 Chaperones and folding catalysts [BR:cge03110]
    100760804
   04131 Membrane trafficking [BR:cge04131]
    100760804
   03051 Proteasome [BR:cge03051]
    100760804
   03029 Mitochondrial biogenesis [BR:cge03029]
    100760804
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100760804
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100760804
Spliceosome [BR:cge03041]
 Complex B
  Other components
   Prp19 complex
    100760804
 Complex C
   Prp19-CDC5 complex
    100760804
Ribosome biogenesis [BR:cge03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100760804
Chaperones and folding catalysts [BR:cge03110]
 Heat shock proteins
  HSP70 / DNAK
   100760804
Membrane trafficking [BR:cge04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100760804
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100760804
Proteasome [BR:cge03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100760804
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100760804
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100760804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C DUF1464
Motif
Other DBs
NCBI-GeneID: 100760804
NCBI-ProteinID: XP_027244613
UniProt: G3HZE7
Position
1
AA seq 641 aa AA seqDB search
MAANKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVLVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLFEGIDFYTSIT
RARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEGQREKIAA
KNALESYAFNMKSAVSDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKE
LENMCNPVITKLYQGGCTGPTCAPGYTPSRAATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaataaaggaatggccataggcatcgacctaggcaccacctactcgtgcgtg
ggcgtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacc
cccagctacgtggccttcaccgacaccgagcggctgatcggagacgccgccaagaaccag
gtggccatgaacccccagaacactgtttttgatgccaaacgtctaattggcaggaagttt
aatgatcctgttgtacagtcggacatgaagctttggccatttcaagtgatcaacgaagcg
ggcaagcccaaggtgctggtgtcctacaaaggagagaagaaagccttctaccccgaggag
atctcgtccatggtgctgacgaagatgaaggagactgcagaggcttttctgggtcacaat
gtcaccaacgcggtgatcacggtgcccgcctatttcaatgactcgcagcgccaggccacc
aaggacgcgggtgtcatcgccggactcaacgtgctcagaattatcaacgagcccacggcg
gccgccatcgcctacgggttggataaaggaagtcatggggagaggcacgtgctcatcttc
gacctggggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgag
gtgaaggccacggcgggggacacccacctgggcggcgaggacttcgacaaccggctggtg
agccacttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgc
gcggtgcggcggctgcgcacggcctgcgagcgcgccaagaggaccctgtcgtccagcacc
caggccaacctggagatcgactccctgttcgagggcatcgacttctacacgtccatcacg
cgggcgcggttcgaggagctgtgtgcagacctattcagaggcaccctggagcccgtggag
aagtcccttcgggacgccaagatggacaaggctaaaatccatgacattgtcctggtgggc
ggctccacgcgcatccccaaggtgcagaagctgctgcaggactactttaacggacgggac
ctcaacaagagcatcaacccggacgaggcggtggcctacggggcggcggtgcaggcggct
attttaatgggtgacaagtctgaaaaggtacaagatttgcttttgttggacgtggctccc
ctgtctctaggactggagacggcgggcggcgtgatgactgttctcatcaagcgcaactcc
accattcccaccaagcagacgcagatcttcaccacctactcggacaaccagcccggcgtg
ctgatccaggtgtacgagggcgagcgggccatgacgcgcgacaacaacctgctgggccgc
tttgacctgactggaataccgcctgcacctaggggcgtgccccagatcgaggtgaccttc
gacatcgatgccaatggaattctcaatgtcacagccatggacaagagcaccggcaaggcc
aacaagatcaccatcaccaacgacaagggccggctgagcaaggaggagatcgagcgcatg
gtgcaggaggccgagaagtacaaagccgaggacgagggccagagggagaaaatcgcggcc
aaaaatgccttagagtcctacgcgtttaacatgaagagcgccgtgagtgacgagggtctg
aaggacaagatcagcgagtccgacaaaaagaagatactggacaagtgtaacgaggtcctt
tcctggctggaggccaaccaactggctgagaaagacgagttcgaccataagagaaaagag
ttggagaacatgtgtaacccggtcatcaccaaactctaccagggagggtgcacagggccc
acctgcgcaccggggtacacgcccagcagggctgccacaggccccaccatcgaggaagta
gattag

KEGG   Cricetulus griseus (Chinese hamster): 100764750Help
Entry
100764750         CDS       T02813                                 

Gene name
Hspa2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03040  Spliceosome
cge04010  MAPK signaling pathway
cge04141  Protein processing in endoplasmic reticulum
cge04144  Endocytosis
cge04213  Longevity regulating pathway - multiple species
cge04612  Antigen processing and presentation
cge04915  Estrogen signaling pathway
cge05134  Legionellosis
cge05145  Toxoplasmosis
cge05162  Measles
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100764750 (Hspa2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100764750 (Hspa2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100764750 (Hspa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100764750 (Hspa2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100764750 (Hspa2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100764750 (Hspa2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100764750 (Hspa2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100764750 (Hspa2)
  09172 Infectious disease: viral
   05162 Measles
    100764750 (Hspa2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100764750 (Hspa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100764750 (Hspa2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cge03041]
    100764750 (Hspa2)
   03009 Ribosome biogenesis [BR:cge03009]
    100764750 (Hspa2)
   03110 Chaperones and folding catalysts [BR:cge03110]
    100764750 (Hspa2)
   04131 Membrane trafficking [BR:cge04131]
    100764750 (Hspa2)
   03051 Proteasome [BR:cge03051]
    100764750 (Hspa2)
   03029 Mitochondrial biogenesis [BR:cge03029]
    100764750 (Hspa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100764750 (Hspa2)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100764750 (Hspa2)
Spliceosome [BR:cge03041]
 Complex B
  Other components
   Prp19 complex
    100764750 (Hspa2)
 Complex C
   Prp19-CDC5 complex
    100764750 (Hspa2)
Ribosome biogenesis [BR:cge03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100764750 (Hspa2)
Chaperones and folding catalysts [BR:cge03110]
 Heat shock proteins
  HSP70 / DNAK
   100764750 (Hspa2)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100764750 (Hspa2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100764750 (Hspa2)
Proteasome [BR:cge03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100764750 (Hspa2)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100764750 (Hspa2)
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100764750 (Hspa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG DUF1464 DDR CRIC_ras_sig Zincin_2
Motif
Other DBs
NCBI-GeneID: 100764750
NCBI-ProteinID: XP_027274095
UniProt: G3H4Z8
Position
5
AA seq 634 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGGGSGGPTIEEVD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccgcggcccggctatcggcatcgacctgggcaccacatactcctgcgtgggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggcaaccgcaccaccccc
agctacgtggccttcaccgacacggagcgcctcatcggcgacgccgccaagaaccaagtg
gccatgaaccccacgaacactatcttcgatgccaagaggctgatcgggcggaagttcgag
gacgccacggtgcagtcagacatgaagcactggccgttcagagtggtgagcgagggtggg
aagcccaaagtgcaggtggaatataaaggggagatgaagaccttcttccccgaggagatc
tcctccatggtcctcacgaagatgaaagagatcgccgaagcctacctggggggcaaggtg
cagagcgcggtcatcaccgtccccgcctatttcaacgactcgcagcgccaggccaccaaa
gacgcgggcaccatcacggggctcaatgtgctgcgcatcatcaacgagcccacggcagcg
gccatcgcctatggcctggacaagaaaggctgcgcaggcggcgagaagaacgtgctcatc
tttgacctgggcggcggcaccttcgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtccacggccggagacacacacctgggtggcgaagacttcgacaaccgtatg
gtgagccacctggcggaggagttcaagcgcaaacacaagaaggacattgggcccaacaag
cgcgccgtgcgccggctgcgcaccgcctgcgagcgcgccaagcgcaccctgagctcgtcc
acgcaggccagcatcgagatcgactcgctctacgagggcgtggatttctacacgtccatc
acccgcgcccgcttcgaggagctcaacgccgacctcttccgagggaccctggagccggtg
gaaaaggcgctgcgcgatgccaagctggacaagggccagatccaggagattgtgctggtg
ggcggctccacccgcatccctaagatccagaagctcctgcaggatttcttcaacggcaag
gagctgaataagagcatcaaccccgacgaggcggtggcctatggcgccgccgtgcaggcg
gctatcctcattggcgacaagtcagagaatgtgcaggatctgctgttactcgacgtgact
ccactgtcgcttggtatcgaaaccgctggcggggtcatgaccccgctcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcactacctactcagacaaccagagcagc
gtgctggtgcaagtgtacgagggcgaacgggccatgaccaaggacaataacctcttgggc
aagttcgacctgactgggatccccccagcaccccgtggggtcccccagatcgaggtcacc
ttcgacatcgatgccaatggcatccttaacgtcaccgctgccgacaagagcactggcaaa
gaaaataagatcaccatcaccaacgacaagggtcgcctgagcaaggacgacattgaccgt
atggtgcaggaggcagagcggtacaaatcggaagatgaagctaatcgcgatcgcgtggca
gccaaaaacgcagttgagtcctatacctacaacatcaaacagacggtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctggaccggaaccagatggcagagaaagatgagtacgaacacaagcaaaaa
gagcttgagagagtgtgcaaccccatcatcagcaaactttaccaaggcggtcctggcgga
ggcggcggcggctctggaggacccaccatcgaggaagtggactaa

KEGG   Cricetulus griseus (Chinese hamster): 100772623Help
Entry
100772623         CDS       T02813                                 

Gene name
Cryab
Definition
(RefSeq) alpha-crystallin B chain
  KO
K09542  crystallin, alpha B
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04141  Protein processing in endoplasmic reticulum
cge04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100772623 (Cryab)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100772623 (Cryab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cge03110]
    100772623 (Cryab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100772623 (Cryab)
Chaperones and folding catalysts [BR:cge03110]
 Heat shock proteins
  HSP20
   100772623 (Cryab)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100772623 (Cryab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Crystallin HSP20 ArsA_HSP20
Motif
Other DBs
NCBI-GeneID: 100772623
NCBI-ProteinID: XP_027267956
Position
4
AA seq 175 aa AA seqDB search
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSW
IDTGLSEMRMEKDRFSVNLDVKHFSPEELKVKVLGDVVEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQASGPERTIPITREEKPAVTAAPKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgccatccaccacccctggatccgtcgtcccttcttccctttccactccccc
agccgtctctttgaccagttcttcggagagcacctgttggagtctgacctcttctcaact
gccacttctctgagccccttctaccttcggccaccctccttccttcgggcacccagctgg
attgacactggactctcagagatgcgtatggagaaggacagattctctgtcaacctggac
gtgaagcacttctccccagaggagctgaaagtcaaggtgctgggagacgtggttgaagtg
catggcaagcacgaagaacgccaggacgaacacggtttcatctctagggagttccacagg
aagtaccggatcccagctgatgtggatcctctgaccattacttcatccctatcatctgat
ggggtcctcactgtgaatggaccaaggaaacaggcctctggccccgagcgtaccattccc
atcacccgtgaagagaagcctgctgtcactgcagcccctaagaagtag

DBGET integrated database retrieval system