KEGG   Cricetulus griseus (Chinese hamster): 100750728Help
Entry
100750728         CDS       T02813                                 

Definition
(RefSeq) nuclear body protein SP140 isoform X1
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100750728
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cge03110]
    100750728
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100750728
Enzymes [BR:cge01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100750728
Chaperones and folding catalysts [BR:cge03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100750728
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100750728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase HSR SAND
Motif
Other DBs
NCBI-GeneID: 100750728
NCBI-ProteinID: XP_027253224
Position
2
AA seq 401 aa AA seqDB search
MAEEDSRSSSWSTTEDEREEGSDDYRPKFKLFKENKVEIASAITKPFPFLMSLRDRGFLS
EQKFQISKKQCKNLDAVRNVVYDILCDLQKDFSLPLLEVIFSPTHLKAYPDLQETRKIFQ
DDTMETGNNTTLGKSQEKRDTVETRNNTTVGKSQEKTNYRGAGGQAAVRRRQRKSNPEGS
VRTVRRRARRLSRNEAVRFKAELLPVTCGRTKGVLHKDKFKLGLCRCRCPPSPVPAAMVN
PTVFFDITANGQPLGRVSFELFADKLPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQ
GGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLD
GKHVVFGKVKEGMSTVEAMERFGSRTGKTSKKITISNCGQL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaggacagtagatcgagcagctggtcaaccactgaggatgagagggaagag
gggtcagatgactataggcccaagttcaagctcttcaaagaaaataaggtggaaatcgca
agcgccatcacaaagccatttcctttccttatgagtcttcgagaccgtggattcctctct
gagcagaagttccagatttctaaaaaacaatgcaagaacctggatgcagtgagaaatgtg
gtgtatgacatcctctgtgacctgcagaaggactttagcctgccgcttctggaagtgatc
tttagcccaacgcatctgaaggcctacccagacttacaggagactcgaaaaatcttccaa
gatgataccatggagactggaaacaacactactctaggaaaatcccaggagaagagagat
accgtggagactagaaacaacactactgtaggaaaatcccaggagaagacaaattacaga
ggagctggtggccaggcagctgtcaggagaaggcaaaggaaaagcaatccagaaggctct
gtcaggactgtcaggcgtagggctcgaagactgagcaggaatgaagctgtgcgattcaag
gctgagttgcttcctgtgacgtgtgggcgcacgaagggagtgttacacaaggataaattc
aagctagggctttgcagatgccgctgtcccccgtcgcctgttcctgcagccatggtcaac
cccactgtgttcttcgacatcacggccaatggccagcccttgggccgcgtctccttcgag
ctatttgcagacaaacttccaaagacagcagaaaactttcgtgctctgagcactggagag
aaaggatttggatataagggttcctcctttcacagaattatcccaggattcatgtgccag
ggtggtgacttcacacgccataatggcactggcggcaggtccatctatggagagaaattt
gaggatgagaacttcatcctgaagcatacaggtcctggcatcttgtccatggcaaatgct
ggaccaaacacaaatggttcccagttttttatctgcactgccaagactgagtggctggat
ggcaaacatgtggtctttgggaaggtgaaagaaggcatgagcactgtggaagccatggag
cgtttcgggtccaggactggcaagaccagcaagaagatcaccatttccaactgtgggcaa
ctctaa

DBGET integrated database retrieval system