KEGG   Cricetulus griseus (Chinese hamster): 100750937Help
Entry
100750937         CDS       T02813                                 

Definition
(RefSeq) glutathione S-transferase Mu 2 isoform X2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00480  Glutathione metabolism
cge00980  Metabolism of xenobiotics by cytochrome P450
cge00982  Drug metabolism - cytochrome P450
cge00983  Drug metabolism - other enzymes
cge01100  Metabolic pathways
cge01524  Platinum drug resistance
cge05200  Pathways in cancer
cge05204  Chemical carcinogenesis
cge05225  Hepatocellular carcinoma
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100750937
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100750937
   00982 Drug metabolism - cytochrome P450
    100750937
   00983 Drug metabolism - other enzymes
    100750937
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100750937
   05204 Chemical carcinogenesis
    100750937
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100750937
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100750937
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100750937
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cge02000]
    100750937
Enzymes [BR:cge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100750937
Transporters [BR:cge02000]
 Other transporters
  Pores ion channels [TC:1]
   100750937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 100750937
NCBI-ProteinID: XP_027251268
Position
1
AA seq 216 aa AA seqDB search
MPVTLGYWDIRGLCHAIRLLLEYTETSYEEKRYAMGDAPDYDQSQWLNEKFRLGLDFPNL
PYLIDGSHKITQSNAILRYLARKHNLCGETEEERIRVDILENQVMDTRIQLAMVCYSPEF
EKRKPEYLEGLPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDVLDQQQLFEPKCLDAFPN
LKDFMARFEALKTISAYVKSSRFLPRPVYLKTAKWK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgacactgggttactgggatatccgtgggttatgtcacgccatccgcctgctc
ctggaatacacagagacaagctatgaggagaagagatatgccatgggggacgctcctgac
tatgaccaaagccagtggctgaatgagaagttcaggctgggcctggactttcccaatctg
ccctacttaattgatgggtcccacaagatcacccagagcaacgccatcctgcgctacctt
gcccgcaagcacaacctgtgtggggagacagaagaggaaaggattcgtgtggacattttg
gagaaccaggtcatggacacccgcattcagcttgcgatggtctgctacagccctgagttt
gagaaacggaagccagagtatttagagggtctcccagagaagatgaagctctactcggag
ttcctgggaaagcggccatggtttgcaggggacaaggtcacctatgtggatttcctcgct
tatgatgtccttgaccagcagcaactgtttgagcccaagtgcctggacgccttcccaaac
ctgaaggacttcatggcccgctttgaggccctcaagacgatctctgcctacgtgaagtct
agccgcttccttccaaggcctgtgtatctgaagacagccaagtggaagtag

DBGET integrated database retrieval system