KEGG   Cricetulus griseus (Chinese hamster): 100751372Help
Entry
100751372         CDS       T02813                                 

Gene name
Adcy9
Definition
(RefSeq) adenylate cyclase type 9 isoform X1
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04961  Endocrine and other factor-regulated calcium reabsorption
cge04962  Vasopressin-regulated water reabsorption
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100751372 (Adcy9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100751372 (Adcy9)
   04371 Apelin signaling pathway
    100751372 (Adcy9)
   04020 Calcium signaling pathway
    100751372 (Adcy9)
   04072 Phospholipase D signaling pathway
    100751372 (Adcy9)
   04024 cAMP signaling pathway
    100751372 (Adcy9)
   04022 cGMP-PKG signaling pathway
    100751372 (Adcy9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100751372 (Adcy9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100751372 (Adcy9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100751372 (Adcy9)
   04062 Chemokine signaling pathway
    100751372 (Adcy9)
  09152 Endocrine system
   04911 Insulin secretion
    100751372 (Adcy9)
   04923 Regulation of lipolysis in adipocytes
    100751372 (Adcy9)
   04912 GnRH signaling pathway
    100751372 (Adcy9)
   04913 Ovarian steroidogenesis
    100751372 (Adcy9)
   04915 Estrogen signaling pathway
    100751372 (Adcy9)
   04914 Progesterone-mediated oocyte maturation
    100751372 (Adcy9)
   04921 Oxytocin signaling pathway
    100751372 (Adcy9)
   04926 Relaxin signaling pathway
    100751372 (Adcy9)
   04935 Growth hormone synthesis, secretion and action
    100751372 (Adcy9)
   04918 Thyroid hormone synthesis
    100751372 (Adcy9)
   04928 Parathyroid hormone synthesis, secretion and action
    100751372 (Adcy9)
   04916 Melanogenesis
    100751372 (Adcy9)
   04925 Aldosterone synthesis and secretion
    100751372 (Adcy9)
   04927 Cortisol synthesis and secretion
    100751372 (Adcy9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100751372 (Adcy9)
   04270 Vascular smooth muscle contraction
    100751372 (Adcy9)
  09154 Digestive system
   04970 Salivary secretion
    100751372 (Adcy9)
   04971 Gastric acid secretion
    100751372 (Adcy9)
   04972 Pancreatic secretion
    100751372 (Adcy9)
   04976 Bile secretion
    100751372 (Adcy9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100751372 (Adcy9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100751372 (Adcy9)
  09156 Nervous system
   04724 Glutamatergic synapse
    100751372 (Adcy9)
   04727 GABAergic synapse
    100751372 (Adcy9)
   04725 Cholinergic synapse
    100751372 (Adcy9)
   04723 Retrograde endocannabinoid signaling
    100751372 (Adcy9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100751372 (Adcy9)
  09149 Aging
   04211 Longevity regulating pathway
    100751372 (Adcy9)
   04213 Longevity regulating pathway - multiple species
    100751372 (Adcy9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100751372 (Adcy9)
   04714 Thermogenesis
    100751372 (Adcy9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100751372 (Adcy9)
  09165 Substance dependence
   05032 Morphine addiction
    100751372 (Adcy9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100751372 (Adcy9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100751372 (Adcy9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100751372 (Adcy9)
   05163 Human cytomegalovirus infection
    100751372 (Adcy9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100751372 (Adcy9)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100751372 (Adcy9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF512 DUF1053
Motif
Other DBs
NCBI-GeneID: 100751372
NCBI-ProteinID: XP_027279823
Position
7
AA seq 1373 aa AA seqDB search
MASSPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNTHPKHCKYSISSSCSSSGDS
GGLPRRMGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYVGFACLLWSIYFAVHMRSKVIVMVVPALCFLVVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVWTPLLGRVDSSNQTLIAKAAADTCLSQVGLFSMCIEVLFLLYTVMH
LPLYLSLFLGVAYSVLFETFGYHFRNEDCFPSPGPGALHWELLSRALLHVCIHAIGIHLF
VMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVK
RHTTSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLL
NDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQE
KKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYL
DDRYEMEDGRVIERLGQSVVADQLKGLKTYLISGQRAKESHCSCAEALLSGFEVIDGSRA
SSGPRGQGTASPGSVSDLAQTVKTFDNLKTCPACGITFAPKSEAGAEGGAVQNGCQDEPK
TGTKVTSSWLLFLSVPLLAHPPKASGGPNSKTQNGLLSPPPEEKLTNSQTSLCEILQEKG
RWAGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELE
RSYRTSYQEEVIKNSPVKTFASATFSSLLDVFLSTTVFLILSITCFLKYAATATPPPPAA
LAVFGADLLLEVLSLVVSIRMVFFLEDVMVCTKRLLEWIAGWLPRHCIGAILVSLPALAV
YSHITSEFETNIHFTMFTGSAVLVAVVHYCNFCQLSSWMRSSLATIVGAGPLLLLYISLC
RDSSIVISPLDTAQNFSANRNPCNSSLLQDSRRPASLIGKELALTFFLLLLLVWFLNREF
EVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVI
FASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGL
NTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTT
KLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTY
LYPKCMDNGVVPQHQLSISPDIRVQVDGSIGRSPTDEIANLVPSVQYTDKTSLGSDDNTQ
AKEVHLSCKRPWREPVKAEERFRFGKAIEKDDCEDTGIEEANELTKLNVSKSV
NT seq 4122 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaccccaccagcagctgctgcatcaccatagcaccgaggtgagctgcgac
tcgagcggagacagcaacagcgtgagggtcaagattaaccctaagcagctgtcctccaac
acccacccgaagcactgcaagtacagcatctcgtccagctgtagcagctcgggagactcc
ggggggcttccccggcggatgggcggcgggggtcgcctgcgcaggcagaagaaactgccc
cagttgttcgagagggcttctagccggtggtgggaccccaaattcgactccgtgaacctg
gaggaggcctgtctggagcgttgcttccctcagacccagcgccgcttccggtacgcactc
ttctatgtgggcttcgcctgccttctctggagcatctacttcgctgtccacatgagatcc
aaagtgattgtcatggtggtcccggctctgtgcttcctagtggtgtgtgtgggctttttc
ctgtttacttttaccaagctgtacgcccggcattatgcgtggacctcactggctctcacc
ctgctggtgtttgccctgaccctggctgcgcagtttcaggtttggacacctctgttagga
cgtgttgacagctccaatcaaactctcatagccaaggcggcggcagatacttgcttatct
caagtggggctcttctccatgtgcattgaagtgctctttttgctctacacggtcatgcac
ttacctctgtacctgagcttgtttttgggggtggcctattctgtcctttttgagaccttc
ggttatcatttccgaaatgaagactgcttcccctccccaggacctggggccctgcactgg
gagctgctgagcagagccctgctccacgtgtgcattcacgccatcgggatccatctgttt
gtcatgtctcaggtgaggtccaggagcaccttcctcaaggtgggacagtccattatgcac
ggcaaagatctggaagtagaaaaagccctcaaagagaggatgattcattctgtgatgcca
agaatcatagctgatgacttaatgaaacaaggggatgaggagagcgagaattctgtcaag
aggcacaccacctccagtcccaagaacaggaagaagaagtcctccatacagaaagcgcct
atagcattccgcccttttaagatgcagcagattgaagaggtcagtattttatttgcagac
atcgtgggcttcaccaagatgagtgccaacaaatccgctcatgccttggtaggtctcctc
aatgatttgtttggtcgatttgaccggttgtgtgaggagaccaagtgtgagaagatcagc
actctgggagactgttattattgtgtggcagggtgtccggagcccagggcagaccatgcc
tactgctgcattgaaatgggcttaggcatgataaaagctatcgagcagttctgccaggag
aagaaagagatggtgaacatgcgtgtcggggttcacacggggactgtcttatgtggcatc
ctgggcatgaggaggtttaaattcgatgtatggtccaatgatgtgaacttggctaatctc
atggagcagttgggagtggctggcaaagttcacatatctgaggccactgcaaaataccta
gacgacaggtatgaaatggaagatgggagagttatcgaacgacttggccagagtgtggtc
gctgaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtct
cactgcagctgtgcagaggccctgctttctggctttgaggtcattgacggctcacgggcg
tcctcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcacag
actgtcaaaacctttgataaccttaagacttgccctgcttgtggaatcacatttgctccc
aaatctgaagctggtgcagaaggaggagctgtgcaaaatggctgtcaagatgagcctaag
accggcaccaaggtaacaagctcatggctgttgttcctgtcagtacctctcctggcgcat
ccacctaaggcttctggaggacccaactctaaaacccagaacggactcctgagccctcct
ccagaggagaagctcaccaacagccagacctccctgtgtgagatcctacaggagaaggga
cggtgggcaggtgtgagcttagaccagtcagccctccttccgctgaggttcaagaacatt
cgtgagaaaactgatgcccactttgtggatgtcatcaaagaagacagcctgatgaaagat
tatttcttcaagccacccatcaatcagttcagcctgaacttcctggaccaggagctggag
cgatcctacagaaccagctaccaggaagaggtcatcaagaattctcctgtgaagactttt
gccagcgccaccttcagttccctcctggacgtgtttctgtccaccacggtgttcctgatc
ctctccatcacctgcttcctaaaatatgcagccaccgccactcctcccccaccggctgcc
ctggctgtctttggtgcagacctgctgctggaggtgctgtccctagtagtgtccatcaga
atggtgttcttcctagaggatgtcatggtgtgcacaaagcgcttgctggaatggatcgct
ggctggctccctcgacactgcattggggccatcttggtatctcttcctgccctggctgtc
tattcacacatcacctctgagtttgagacaaacatacatttcaccatgttcacaggctct
gctgtgctggtggccgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctcccttgccaccatcgtgggcgctgggccgttgcttctgctctacatctccctgtgc
cgggacagttccatagtgatatcacccttggatacagcacagaacttcagtgccaacagg
aacccatgcaacagctcactgctgcaggacagcaggaggccagcaagcctcataggcaag
gagcttgccctcaccttcttcctcctgctcctcttggtctggttcctgaaccgagagttc
gaggtcagctaccgcctgcactaccatggggacgtggaagcggatctgcaccgcaccaag
atccagagcatgagggaccaggctgactggctgttgaggaacatcatcccctaccatgtg
gctgagcagctcaaagtctcccagacctactccaagaaccatgacagtggaggagtgatc
tttgccagcatcgtcaacttcagtgaattctatgaagagaactatgaggggggcaaggaa
tgctaccgggtccttaatgagctgataggtgactttgatgagcttctgagcaagccagac
tataacagcattgagaagattaagaccattggggccacatacatggcagcatcagggctg
aacaccgcccagtgccaggagggtggccacccacaggagcatctgcgtatcctctttgag
tttgccaaggagatgatgcgtgtggtggatgacttcaacaacaacatgttgtggttcaac
ttcaaactcagggttggctttaaccatggacccctcacggcaggtgtcattggtaccacc
aaactgctatatgacatctggggggacaccgtcaacattgccagcaggatggacaccact
ggtgttgagtgtcgcatccaggtgagcgaagagagctaccgtgtgctgagcaagatgggt
tatgactttgactaccgagggactgtgaacgtcaaggggaaagggcagatgaagacctac
ctttatccaaagtgcatggacaatggggttgtgccccagcaccagctgtccatctcccca
gacatccgtgtccaggtggacggcagcattggacggtctcctacagacgagattgccaac
ttggtgccttctgttcagtacacggacaagacttccttgggatctgatgacaacacacag
gccaaggaagtgcacctgtcctgtaagagaccctggagagagccggtcaaagctgaagaa
aggtttcgatttggaaaagccatagaaaaggatgactgtgaagacacgggaatagaagaa
gccaatgaactcaccaagctcaatgtctcaaagagtgtatga

KEGG   Cricetulus griseus (Chinese hamster): 100756132Help
Entry
100756132         CDS       T02813                                 

Gene name
Adcy7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100756132 (Adcy7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100756132 (Adcy7)
   04371 Apelin signaling pathway
    100756132 (Adcy7)
   04020 Calcium signaling pathway
    100756132 (Adcy7)
   04072 Phospholipase D signaling pathway
    100756132 (Adcy7)
   04024 cAMP signaling pathway
    100756132 (Adcy7)
   04022 cGMP-PKG signaling pathway
    100756132 (Adcy7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100756132 (Adcy7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100756132 (Adcy7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100756132 (Adcy7)
   04062 Chemokine signaling pathway
    100756132 (Adcy7)
  09152 Endocrine system
   04911 Insulin secretion
    100756132 (Adcy7)
   04923 Regulation of lipolysis in adipocytes
    100756132 (Adcy7)
   04912 GnRH signaling pathway
    100756132 (Adcy7)
   04913 Ovarian steroidogenesis
    100756132 (Adcy7)
   04915 Estrogen signaling pathway
    100756132 (Adcy7)
   04914 Progesterone-mediated oocyte maturation
    100756132 (Adcy7)
   04921 Oxytocin signaling pathway
    100756132 (Adcy7)
   04926 Relaxin signaling pathway
    100756132 (Adcy7)
   04935 Growth hormone synthesis, secretion and action
    100756132 (Adcy7)
   04918 Thyroid hormone synthesis
    100756132 (Adcy7)
   04928 Parathyroid hormone synthesis, secretion and action
    100756132 (Adcy7)
   04916 Melanogenesis
    100756132 (Adcy7)
   04925 Aldosterone synthesis and secretion
    100756132 (Adcy7)
   04927 Cortisol synthesis and secretion
    100756132 (Adcy7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100756132 (Adcy7)
   04270 Vascular smooth muscle contraction
    100756132 (Adcy7)
  09154 Digestive system
   04970 Salivary secretion
    100756132 (Adcy7)
   04971 Gastric acid secretion
    100756132 (Adcy7)
   04972 Pancreatic secretion
    100756132 (Adcy7)
   04976 Bile secretion
    100756132 (Adcy7)
  09156 Nervous system
   04724 Glutamatergic synapse
    100756132 (Adcy7)
   04727 GABAergic synapse
    100756132 (Adcy7)
   04725 Cholinergic synapse
    100756132 (Adcy7)
   04723 Retrograde endocannabinoid signaling
    100756132 (Adcy7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100756132 (Adcy7)
  09149 Aging
   04211 Longevity regulating pathway
    100756132 (Adcy7)
   04213 Longevity regulating pathway - multiple species
    100756132 (Adcy7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100756132 (Adcy7)
   04714 Thermogenesis
    100756132 (Adcy7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100756132 (Adcy7)
  09165 Substance dependence
   05032 Morphine addiction
    100756132 (Adcy7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100756132 (Adcy7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100756132 (Adcy7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100756132 (Adcy7)
   05163 Human cytomegalovirus infection
    100756132 (Adcy7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100756132 (Adcy7)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100756132 (Adcy7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Motif
Other DBs
NCBI-GeneID: 100756132
NCBI-ProteinID: XP_027261326
UniProt: A0A3L7HZN2
Position
3
AA seq 1100 aa AA seqDB search
MPAKGRYFLNEGDEGPNQAKLYEKYRLTSQHGPLLLLLLLVAVATCIALIIITFSHEDPP
RHQAILGTAFFMLTLFVALYVLVYVECLVRRWLWALALLTWACLMMLGFVLVWDSWKNDA
CAWEQVPFFLFIVFVVYALLPLSTRAAITVGMVSTVSHLLMFGAVTGAFKMSVSGAQLAL
QLLANAIILLGGNFTGAFHKHQLQDASRDLFIYTVKCIQIRRKLRVEKRQQENLLLSVLP
AHISMGMKLAIIERLKEGGDHRHMPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPK
ELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAI
KQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
ATLNHLDKAYEVEDGNGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSHHLPKPKGDATLKI
RASVRVTRYLESWGAARPFAHLNHRESVSSSETPSPTGQRPKATPLRRHRAIDRSTSPKG
RLEDDCDDEMLSAIEGLSSTRPCCSKSDDFHTFGPIFLEKGFEREYRLVPIPRARYDFAC
ASLVFICILLVHLLVMPRMATLGVSFGLVACLLGLVLSFCFATEFSRCFPARGTLQAISE
SVETQPLLRLSLVVLTVGSLLTVAIINMPLMLSPGPEWPGGNETSSLAARNRVGIPCELL
LYYTCSCILGFISCSVFLRMSLELKALLLTVALVAYLLLFNLSPCWHVPGNSTETNSTHR
TQTLLPAGQSTPSHTLALGAQVTASSPGRCLEKDLKTMINFYLVLFYATLILLSRQIDYY
CRLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYDCVCV
MFASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAA
AGLSIPSGHENQDLERQHAHIGVLVEFSMALMSKLDGINRHSFNSFRLRVGINHGPVIAG
VIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKG
ELRTYFVCTDTAKFQGLGLN
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaaagggcgctacttcctaaatgagggtgatgaaggccccaaccaggcaaag
ctctatgagaagtaccgcctcaccagccagcatgggccactgttgctcttgctcctcctg
gtggctgtggccacctgcatcgcactcatcatcatcaccttcagccatgaggatcccccc
agacaccaggctatcctgggcactgcgttcttcatgctgacgctgtttgtggctctctat
gtgctggtatatgttgagtgcctggtgcggcgatggctgtgggccttggctctactcacc
tgggcctgcctcatgatgctcggctttgtgctggtgtgggactcctggaagaatgatgcc
tgtgcgtgggagcaggtgcctttcttcctgttcattgtctttgtggtgtatgcattactg
cccctcagcacgagggcagccatcacagtggggatggtttccactgtttcccacctcctg
atgtttggagctgtgacaggagccttcaagatgtccgtgtccggagcacagctggcgctg
cagctcctggccaatgccattatcctcctgggtgggaacttcacgggtgccttccacaag
caccagctgcaggatgcttcccgggacctcttcatctacacagtcaagtgcatccagatc
cgccggaagctgcgtgtggagaagcgccagcaggagaacctgctgctttcggtgctccca
gctcacatatccatgggcatgaagctggccatcattgagcgcctcaaagagggtggtgac
caccgccacatgcctgacaacaactttcacagcctctatgtcaagcggcaccagaatgtc
agtatcttgtatgcagacattgtgggcttcacacggctggccagtgactgctcgcccaag
gagctggtggtggtactcaacgagctgttcgggaaatttgaccagattgccaaggccaat
gagtgcatgcggatcaagatcctgggtgactgctactactgtgtgtcaggcctgcctgtg
tcgctgcccacccatgcccgcaactgcgtgaagatgggtctggacatctgtgaggccatt
aagcaggttcgtgaggccacaggagtggacatcagcatgcgtgtgggtatccactccggg
aatgttctgtgtggggtcatcgggctccgcaagtggcagtatgatgtgtggtcccatgat
gtgtccctggccaacaggatggaggcagctggagtccctggccgggtgcacatcacagag
gcgacactgaaccacctggacaaggcatacgaggtggaggatgggaacgggcagcagcgt
gacccctatctgaaagagatgaacatccgaacctacctggtgatcgacccccggagccag
cagccgcctccacccagccatcacctccccaagcccaagggggatgcaaccctgaagatt
cgggcttcagtgcgtgtaacgcgctatctcgagtcctggggggcagcacggcccttcgca
cacctcaaccaccgggagagtgtgagcagcagcgagacccccagtcccactggacagagg
ccaaaagccactcctctgcgccgacaccgtgccattgacaggagtacatcccccaagggg
cgcttggaggatgactgtgatgacgagatgctctcggccatcgagggactcagctccacc
aggccctgctgctccaagtccgatgacttccacacctttggtcccatcttcctggagaag
ggctttgagcgtgagtatcgcctggtgcctatcccccgggctcgctacgactttgcctgt
gccagccttgtcttcatctgcatcctgcttgtccaccttcttgtgatgcccaggatggcc
actctgggcgtgtcctttggactggtggcctgcctgctggggctggtgctgagtttctgc
tttgctactgagttctcaaggtgctttccagcccgaggtacactccaggccatctcggag
agtgtggagacacagcccctgctcaggctatccttggttgtgctgactgttggtagccta
ctgactgttgccatcatcaacatgccactgatgcttagcccaggcccagagtggccagga
ggcaatgagacaagctcgctggctgcaaggaatagagttggaatcccgtgtgagctcctc
ctgtactacacctgcagctgcatcctgggcttcatctcgtgctccgttttcctgcggatg
agcctggaactgaaggccctgctgctgacagtggccttggtggcttacctgctgctcttc
aacctctccccctgctggcatgttccaggcaacagcactgaaaccaacagtacacacagg
acacaaacactcctgcctgctggacaaagcacacccagccacacccttgctctgggggct
caggtgactgcctcctcccctggcagatgtttagagaaagatctgaagaccatgatcaac
ttctacctggtcctgttctatgccaccctcatcttgctgtctagacagattgactactat
tgccgcttggattgtctgtggaagaagaagttcaagaaagagcatgaggagtttgaaaca
atggagaatgtgaaccgcctcctcctggaaaatgttctgccagcgcatgtggctgcccac
ttcattggcgacaaggcggctgaggactggtaccatcagtcttatgactgtgtctgtgtc
atgtttgcctcggttccggacttcaaagtgttctacactgagtgcgatgtcaacaaagaa
gggttggagtgccttcgcctgctgaatgagatcattgctgattttgacgagctgctgctg
aagcccaagttcagtggtgtggagaagattaagaccattggcagcacctatatggctgca
gcagggctcagcatcccctcaggacacgagaaccaggatctggagcggcagcatgcgcac
attggtgtcttggtggagttcagcatggccctgatgagcaagctggatggcatcaacagg
cactccttcaactctttccgcctccgagttggcataaaccatgggcctgtgattgctgga
gtgattggagcacgaaagcctcagtatgacatctggggaaacacagtcaatgttgccagc
cgaatggagagcactggagagcttgggaaaatccaggttacagaagagacgtgcaccatc
ctccagggactaggatattcttgtgagtgccgagggctgatcaacgtcaaaggcaaaggc
gagctgcggacttactttgtgtgtacagacactgccaagtttcaaggactggggctgaac
tga

KEGG   Cricetulus griseus (Chinese hamster): 100764561Help
Entry
100764561         CDS       T02813                                 

Gene name
Adcy1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05142  Chagas disease (American trypanosomiasis)
cge05146  Amoebiasis
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100764561 (Adcy1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100764561 (Adcy1)
   04371 Apelin signaling pathway
    100764561 (Adcy1)
   04020 Calcium signaling pathway
    100764561 (Adcy1)
   04072 Phospholipase D signaling pathway
    100764561 (Adcy1)
   04024 cAMP signaling pathway
    100764561 (Adcy1)
   04022 cGMP-PKG signaling pathway
    100764561 (Adcy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100764561 (Adcy1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100764561 (Adcy1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100764561 (Adcy1)
   04062 Chemokine signaling pathway
    100764561 (Adcy1)
  09152 Endocrine system
   04911 Insulin secretion
    100764561 (Adcy1)
   04923 Regulation of lipolysis in adipocytes
    100764561 (Adcy1)
   04912 GnRH signaling pathway
    100764561 (Adcy1)
   04913 Ovarian steroidogenesis
    100764561 (Adcy1)
   04915 Estrogen signaling pathway
    100764561 (Adcy1)
   04914 Progesterone-mediated oocyte maturation
    100764561 (Adcy1)
   04921 Oxytocin signaling pathway
    100764561 (Adcy1)
   04926 Relaxin signaling pathway
    100764561 (Adcy1)
   04935 Growth hormone synthesis, secretion and action
    100764561 (Adcy1)
   04918 Thyroid hormone synthesis
    100764561 (Adcy1)
   04928 Parathyroid hormone synthesis, secretion and action
    100764561 (Adcy1)
   04916 Melanogenesis
    100764561 (Adcy1)
   04925 Aldosterone synthesis and secretion
    100764561 (Adcy1)
   04927 Cortisol synthesis and secretion
    100764561 (Adcy1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100764561 (Adcy1)
   04270 Vascular smooth muscle contraction
    100764561 (Adcy1)
  09154 Digestive system
   04970 Salivary secretion
    100764561 (Adcy1)
   04971 Gastric acid secretion
    100764561 (Adcy1)
   04972 Pancreatic secretion
    100764561 (Adcy1)
   04976 Bile secretion
    100764561 (Adcy1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100764561 (Adcy1)
   04727 GABAergic synapse
    100764561 (Adcy1)
   04725 Cholinergic synapse
    100764561 (Adcy1)
   04720 Long-term potentiation
    100764561 (Adcy1)
   04723 Retrograde endocannabinoid signaling
    100764561 (Adcy1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100764561 (Adcy1)
  09149 Aging
   04211 Longevity regulating pathway
    100764561 (Adcy1)
   04213 Longevity regulating pathway - multiple species
    100764561 (Adcy1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100764561 (Adcy1)
   04714 Thermogenesis
    100764561 (Adcy1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764561 (Adcy1)
  09165 Substance dependence
   05032 Morphine addiction
    100764561 (Adcy1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100764561 (Adcy1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100764561 (Adcy1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100764561 (Adcy1)
   05163 Human cytomegalovirus infection
    100764561 (Adcy1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100764561 (Adcy1)
   05142 Chagas disease (American trypanosomiasis)
    100764561 (Adcy1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100764561 (Adcy1)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100764561 (Adcy1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Motif
Other DBs
NCBI-GeneID: 100764561
NCBI-ProteinID: XP_027243942
Position
1
AA seq 894 aa AA seqDB search
MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNTF
LRTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADL
NFFTLKYKHVEREQKYHQLQDEYFTSAVVLALILAALFGLVYLLIIPQSVAVLLLLVFSI
CFLVACILYLHITRVQCFPGCLTIQIRTVLCVFIVILIYSVAQGCVVGCLPWAWSSQSNS
SLVVLAAGGRRTVLPALPCESAHHALLCCLVGTLPLAIFLRVSSLPKMILLSGLTTSYIL
VLELSGYTKVGGGALSGHSYEPIMAILLFSCTLALHARQVDVRLRLDYLWAAQAEEERDD
MERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELD
GNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTRAKKSIS
SHLCTLADFAIDMFEVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNV
ASRMDSTGVQGRIQVTEEVHRLLKRCSYQFVCRGKVSVKGKGEMLTYFLEGRTDGNSSHG
RSFRLERRMCPYGRGGGQARRPPLCPAAGPPIRPGLPPAPTSQYLPSTAGGKEA
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgtatggagtctttgtgcggatcttgacagagcgctcacaaaggaaggccttcctgcaa
gctcgaagctgcattgaggaccggctgcggctggaggatgagaacgagaagcaggagagg
ttgctcatgagcctcttgccccggaatgtagccatggagatgaaggaagacttcctgaag
ccccctgagaggattttccacaagatttacatccagaggcatgacaacgtgagcatcctg
tttgcagacattgtgggtttcacgggtctggcatcccagtgcacggcccaggagctggtg
aaactgctcaacgaactttttggcaagtttgacgagttagccacggagaaccactgtcgc
cgcatcaagatccttggggactgctactactgtgtgtcaggcctcacccagcccaagacc
gaccacgcccattgctgtgtggagatgggacttgacatgatcgataccatcacatccgtg
gctgaggctactgaagtagacctgaacatgcgtgtggggctacacaccggcagggtcctc
tgtggtgtcctgggccttcgaaagtggcagtacgatgtatggtccaatgacgtgaccctg
gccaatgtcatggaggctgctggcttacctgggaaggttcacatcacaaagacgactctc
gcgtgcttgaatggggactatgaagtagagccaggtcatggccacgagaggaacaccttc
ctgagaactcacaacatcgagaccttctttattgtgccatcccatcggagaaagatattt
ccgggcttgattctctcagatataaaaccagccaagaggatgaagttcaagactgtctgc
tacctgctggtgcagctcatgcactgccggaaaatgttcaaagctgagatccctttctcc
aacgtaatgacctgtgaggatgatgacaagcggagggcattgagaacagcctcagagaag
ctcagaaaccgctcatctttctctaccaatgtggtctacaccactccgggcacacgtgtc
aacaggtacatcagccgtcttcttgaagcccgccagacagagctggagatggcagatctg
aacttctttaccctgaagtacaaacatgtcgaaagagagcaaaaataccaccagcttcag
gatgagtacttcaccagcgctgttgtccttgccctcatcctggctgccttatttgggctt
gtctaccttctgataattccacagagtgtggctgtcctgctgctgctggtattttctatc
tgcttcttggtggcctgtatcctgtacctgcacatcacgcgggtccagtgttttccaggg
tgcctgacgatccagattcgcactgttttgtgtgtattcatagtgatcttaatctactca
gtagctcaaggatgtgtggtgggctgcctgccctgggcctggagctctcagtccaacagc
tccctagtggtccttgcagctggtggccggcgcactgtgctgcctgccctgccctgtgag
tctgcacaccatgccctgctctgctgcctggtgggcaccctcccgctagccatattcctg
cgggtgtcctccttgccaaagatgatcctgctgtctgggctgaccacatcctacatcctt
gttctggaactcagtggatataccaaggttgggggtggtgccctctctgggcacagctat
gaaccaatcatggctatcctgctgttctcatgcacactggccctgcacgccaggcaagtg
gacgtcagactgcggctggactacctctgggcagcacaggcggaagaggagcgggatgac
atggagagagtgaagctggacaacaagaggatcctcttcaacctcctgccagcccatgtc
gcacagcacttcctcatgtccaatccccggaacatggacctctattaccagtcctactcc
caggtgggcgtcatgtttgcctccatccccaacttcaatgacttctacatcgagctggat
ggcaacaacatgggggttgagtgtctgcgactcctcaatgagatcattgctgacttcgat
gagctcatggacaaggacttttacaaggacctggagaagattaagaccattggtagtacc
tatatggctgccgtgggactggcacccacagcaggaaccagggctaagaagtcaatctct
tcccacctttgcacattagcagactttgccatcgatatgtttgaagtcctggatgaaatc
aactaccaatcctacaacgactttgttctccgagttggcatcaacgttggccctgtggtg
gctggagtgatcggagctcgcaggccccagtacgacatctggggaaacacagtcaatgtg
gccagtcgaatggacagcacaggggtccagggcagaattcaggtaactgaggaggtccat
cggctgctgaagaggtgctcataccagtttgtgtgcagaggcaaagtcagcgtcaagggc
aagggagagatgctaacatactttctagaaggcaggactgatggaaacagttcccatggc
aggtcctttcgattggagcggagaatgtgtccttatgggagaggtggaggccaggcccga
cgtcccccactatgtcctgcagctggacccccgatcaggccggggctccccccagcccca
actagccagtacctgccatccacagcaggggggaaggaagcctag

KEGG   Cricetulus griseus (Chinese hamster): 100765958Help
Entry
100765958         CDS       T02813                                 

Gene name
Adcy5
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 5 isoform X2
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04727  GABAergic synapse
cge04728  Dopaminergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04924  Renin secretion
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05012  Parkinson disease
cge05030  Cocaine addiction
cge05031  Amphetamine addiction
cge05032  Morphine addiction
cge05034  Alcoholism
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100765958 (Adcy5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100765958 (Adcy5)
   04371 Apelin signaling pathway
    100765958 (Adcy5)
   04072 Phospholipase D signaling pathway
    100765958 (Adcy5)
   04024 cAMP signaling pathway
    100765958 (Adcy5)
   04022 cGMP-PKG signaling pathway
    100765958 (Adcy5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100765958 (Adcy5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100765958 (Adcy5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100765958 (Adcy5)
   04062 Chemokine signaling pathway
    100765958 (Adcy5)
  09152 Endocrine system
   04911 Insulin secretion
    100765958 (Adcy5)
   04923 Regulation of lipolysis in adipocytes
    100765958 (Adcy5)
   04912 GnRH signaling pathway
    100765958 (Adcy5)
   04913 Ovarian steroidogenesis
    100765958 (Adcy5)
   04915 Estrogen signaling pathway
    100765958 (Adcy5)
   04914 Progesterone-mediated oocyte maturation
    100765958 (Adcy5)
   04921 Oxytocin signaling pathway
    100765958 (Adcy5)
   04926 Relaxin signaling pathway
    100765958 (Adcy5)
   04935 Growth hormone synthesis, secretion and action
    100765958 (Adcy5)
   04918 Thyroid hormone synthesis
    100765958 (Adcy5)
   04928 Parathyroid hormone synthesis, secretion and action
    100765958 (Adcy5)
   04916 Melanogenesis
    100765958 (Adcy5)
   04924 Renin secretion
    100765958 (Adcy5)
   04925 Aldosterone synthesis and secretion
    100765958 (Adcy5)
   04927 Cortisol synthesis and secretion
    100765958 (Adcy5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100765958 (Adcy5)
   04270 Vascular smooth muscle contraction
    100765958 (Adcy5)
  09154 Digestive system
   04970 Salivary secretion
    100765958 (Adcy5)
   04971 Gastric acid secretion
    100765958 (Adcy5)
   04972 Pancreatic secretion
    100765958 (Adcy5)
   04976 Bile secretion
    100765958 (Adcy5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100765958 (Adcy5)
   04727 GABAergic synapse
    100765958 (Adcy5)
   04725 Cholinergic synapse
    100765958 (Adcy5)
   04728 Dopaminergic synapse
    100765958 (Adcy5)
   04726 Serotonergic synapse
    100765958 (Adcy5)
   04723 Retrograde endocannabinoid signaling
    100765958 (Adcy5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100765958 (Adcy5)
  09149 Aging
   04211 Longevity regulating pathway
    100765958 (Adcy5)
   04213 Longevity regulating pathway - multiple species
    100765958 (Adcy5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100765958 (Adcy5)
   04714 Thermogenesis
    100765958 (Adcy5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100765958 (Adcy5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100765958 (Adcy5)
  09165 Substance dependence
   05030 Cocaine addiction
    100765958 (Adcy5)
   05031 Amphetamine addiction
    100765958 (Adcy5)
   05032 Morphine addiction
    100765958 (Adcy5)
   05034 Alcoholism
    100765958 (Adcy5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100765958 (Adcy5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100765958 (Adcy5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100765958 (Adcy5)
   05163 Human cytomegalovirus infection
    100765958 (Adcy5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100765958 (Adcy5)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100765958 (Adcy5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 100765958
NCBI-ProteinID: XP_027268575
Position
4
AA seq 1263 aa AA seqDB search
MSGSKSVSPPGYAAQTAASPSPAPRGGPEHRAAWGEADSRANGYPHAPGGSARGSTKRSG
GAVTPQQQQRLASRWRGDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDGSRGSRRQ
RRGAAGGGSTRAPPAGGXGGSAAAAAAAGGTEVRPRSVELGLEERRGKGRTTDELEPGTG
TVEDGDGSGDGGSSVGSGSGTGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLN
QSSLTMLMAVLVLVCLVMLAFHAARPPLQIPYLAVLAAAVGVILIMAVLCNRAAFHQDHM
GLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLS
ALHLAISLRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQAR
LHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGF
TSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCV
EMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAG
GKAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAK
MNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDE
FLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFV
QITIVPHSLFMLSFYLSCFLLLALVVFVSVIYACVKLFPTPLQTLSRKIVRSKTNSTLVG
VFTITLVFLSAFVNMFMCNSKNLVGCLAEEHNITVNQVNACHVMESAFNYSLGDEQGFCG
SLQPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNA
DLLVTANAIDFSNNGTSQCPEHATKVALKVVTPIVISVFVLALYLHAQQVESTARLDFLW
KLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIA
NFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDS
TYDKAGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDI
WGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGP
PLS
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgctgcacagacagcggcgtcgccg
tcgccggcgccccggggaggcccggagcatcgcgccgcgtggggagaagcagattcccgc
gccaatggctacccccacgcccccggggggtctgcccgcggctctaccaagagatctggt
ggggcggtgaccccacagcagcagcagcgcctggccagccgttggcgtggcgacgacgac
gacgaccctccactaagcggtgatgaccctctggctgggggcttcggcttcagctttcgt
tccaagtccgcctggcaggagcgcggtggcgacgacggcagtcgcggcagccggcggcag
cggcggggtgcggctggagggggcagcacccgggcgccccctgcgggcggcngcggcggt
tcggcggcggccgcggcggccgcaggtgggacagaggtgcgcccccgctcggtggagctg
ggcctggaggaacgtcgtgggaagggccgcacgaccgatgagctggagcccggcactggc
accgtcgaggatggagacgggtccggggatggcggcagttcggtggggtcaggctctggg
accggcgcggtgctgtcgctgggcgcctgctgcctggccttgctgcagatattccgctct
aagaagttcccgtcggacaaactggagcggctgtaccagcgctacttcttccgcctgaac
cagagcagcctcaccatgctcatggccgtgctggtgctcgtgtgcctggtcatgctggcc
ttccacgcggctcggcccccgctccagataccctacctggccgtgttggcagctgctgtg
ggcgtgatccttatcatggccgtgctctgcaaccgtgcagccttccaccaggaccacatg
ggcctggcctgctatgcactcattgcggtagtgctggccgtccaggtagtgggcctgttg
ctgccgcagccacgcagtgcctccgagggcatctggtggaccgtgttcttcatctacacc
atctacacgctgctgcctgtgcgcatgagggccgcggtgctcagcggggtgcttctgtcg
gccctccacctggccatctctctgcgcaccaacgcccaggaccagtttctgctgaagcag
cttgtctccaatgtcctcatcttctcctgcaccaacattgtgggtgtctgcactcactac
ccagctgaggtctcccagagacaggccttccaggagacccgggagtgtatccaggctcgg
cttcactcacagcgggagaatcaacaacaggagcgtctcctgctgtctgtccttccccgt
catgttgccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccac
aagatttacatccagaaacatgacaatgtgagcatcctgtttgctgacatcgagggcttc
accagcctggcatcccagtgtactgcccaggaactggtcatgaccctcaatgagctcttc
gcccgctttgacaagttggctgcggagaatcactgtttacggattaagatcctcggggat
tgttactactgcgtctctgggctgcctgaagccagggctgaccacgcccactgctgcgtg
gagatgggcatggacatgatcgaggctatctcgttggtccgggaggtgacaggggtgaac
gtgaacatgcgtgtgggaattcacagcgggagagtacactgcggcgtccttggtctcaga
aagtggcagttcgacgtatggtctaacgatgtcacactggccaaccacatggaggctggt
ggcaaagcaggacgcatccatatcaccaaggccacactcaactacctgaatggggactat
gaggtggagccaggctgtggtggcgagcgcaatgcctacctcaaggagcacagcatcgag
accttcctcatcctgcgctgtacccagaagcggaaagaagagaaagccatgattgccaag
atgaaccgccagagaaccaattccatcggacacaacccaccccactggggagctgagcgc
cccttctacaaccacttgggtggtaaccaggtgtccaaggagatgaagaggatgggcttt
gaagaccccaaggacaagaatgcccaggaaagtgccaaccctgaggatgaagtggacgag
tttctgggccgggccattgatgccaggagcattgacagactacggtctgaacacgtccgc
aagttcctcttgaccttcagggagcccgacttagagaagaagtactccaagcaggtggat
gaccgatttggtgcctatgtggcctgtgcctcgcttgttttcctcttcatctgctttgtc
cagatcaccatcgtgccccactccctgttcatgctgagtttctacctgtcgtgtttcctg
ctgctggccttggtggtgtttgtgtccgtgatctacgcctgtgtgaagctcttccccact
cccctgcagacactctccaggaagattgtacgatccaagacaaacagcaccctggttggg
gtgttcaccatcaccctggtgttcctctcagcttttgtcaacatgttcatgtgcaactct
aagaacctagtgggctgcctggcggaggagcacaacatcacggtgaaccaagtcaacgca
tgtcatgtgatggagtcggccttcaactacagcctgggtgacgagcagggcttctgtggt
agcctccagcccaactgcaacttcccagagtacttcacctacagtgtgctgctcagcctg
ctggcctgctccgtgttcctacagatcagctgcatcgggaagctggtgctcatgctggcc
atcgagctcatctatgtgctcatcgttgaggtgcccggtgtcacactctttgacaacgct
gatctcctggtcaccgccaatgccatagacttcagcaacaacgggacttcccagtgccct
gagcatgcgaccaaggtggcgctgaaggtggtgacaccgatcgtcatctctgtcttcgtg
ctggctctgtatctgcatgcccagcaggtggagtccactgctcgccttgacttcctgtgg
aaactgcaggccacagaggagaaagaggagatggaggagctgcaggcctacaacagacga
ctgctgcacaacattctgcccaaggacgtggctgcccacttcctggcccgagagcggcgc
aatgatgagctctactaccagtcctgcgagtgcgtggctgtcatgttcgcctcgatcgcc
aacttctctgaattctatgtggagctagaggccaacaacgagggcgtcgagtgcctgagg
ctgctcaatgagatcatcgcagactttgatgagatcatcagtgaggatcggttcaggcag
ctggaaaagatcaagaccataggtagcacctacatggctgcctctggcctcaacgattct
acctatgacaaggcaggcaagacccacatcaaagctcttgcagactttgccatgaagctg
atggaccagatgaagtacatcaatgagcactccttcaacaacttccagatgaagatcggg
ctcaacattggacccgtagtggctggggtcattggagctcgcaagcctcagtatgatatc
tggggcaatacagtaaatgttgccagccgtatggacagcactggggtgcctgaccgcatc
caggtcactacagacatgtaccaggtgctggccgccaacacataccagctggagtgccgg
ggtgtggtcaaggtcaagggcaagggtgagatgatgacctacttcctcaatggagggcct
cccctcagttag

KEGG   Cricetulus griseus (Chinese hamster): 100768368Help
Entry
100768368         CDS       T02813                                 

Gene name
Adcy6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04742  Taste transduction
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04924  Renin secretion
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04961  Endocrine and other factor-regulated calcium reabsorption
cge04962  Vasopressin-regulated water reabsorption
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100768368 (Adcy6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100768368 (Adcy6)
   04371 Apelin signaling pathway
    100768368 (Adcy6)
   04072 Phospholipase D signaling pathway
    100768368 (Adcy6)
   04024 cAMP signaling pathway
    100768368 (Adcy6)
   04022 cGMP-PKG signaling pathway
    100768368 (Adcy6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100768368 (Adcy6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100768368 (Adcy6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100768368 (Adcy6)
   04062 Chemokine signaling pathway
    100768368 (Adcy6)
  09152 Endocrine system
   04911 Insulin secretion
    100768368 (Adcy6)
   04923 Regulation of lipolysis in adipocytes
    100768368 (Adcy6)
   04912 GnRH signaling pathway
    100768368 (Adcy6)
   04913 Ovarian steroidogenesis
    100768368 (Adcy6)
   04915 Estrogen signaling pathway
    100768368 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    100768368 (Adcy6)
   04921 Oxytocin signaling pathway
    100768368 (Adcy6)
   04926 Relaxin signaling pathway
    100768368 (Adcy6)
   04935 Growth hormone synthesis, secretion and action
    100768368 (Adcy6)
   04918 Thyroid hormone synthesis
    100768368 (Adcy6)
   04928 Parathyroid hormone synthesis, secretion and action
    100768368 (Adcy6)
   04916 Melanogenesis
    100768368 (Adcy6)
   04924 Renin secretion
    100768368 (Adcy6)
   04925 Aldosterone synthesis and secretion
    100768368 (Adcy6)
   04927 Cortisol synthesis and secretion
    100768368 (Adcy6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100768368 (Adcy6)
   04270 Vascular smooth muscle contraction
    100768368 (Adcy6)
  09154 Digestive system
   04970 Salivary secretion
    100768368 (Adcy6)
   04971 Gastric acid secretion
    100768368 (Adcy6)
   04972 Pancreatic secretion
    100768368 (Adcy6)
   04976 Bile secretion
    100768368 (Adcy6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100768368 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100768368 (Adcy6)
  09156 Nervous system
   04724 Glutamatergic synapse
    100768368 (Adcy6)
   04727 GABAergic synapse
    100768368 (Adcy6)
   04725 Cholinergic synapse
    100768368 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    100768368 (Adcy6)
  09157 Sensory system
   04742 Taste transduction
    100768368 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    100768368 (Adcy6)
  09149 Aging
   04211 Longevity regulating pathway
    100768368 (Adcy6)
   04213 Longevity regulating pathway - multiple species
    100768368 (Adcy6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100768368 (Adcy6)
   04714 Thermogenesis
    100768368 (Adcy6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768368 (Adcy6)
  09165 Substance dependence
   05032 Morphine addiction
    100768368 (Adcy6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100768368 (Adcy6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100768368 (Adcy6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100768368 (Adcy6)
   05163 Human cytomegalovirus infection
    100768368 (Adcy6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100768368 (Adcy6)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100768368 (Adcy6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa VIT1
Motif
Other DBs
NCBI-GeneID: 100768368
NCBI-ProteinID: XP_027252258
UniProt: G3I6K2
Position
2
AA seq 1180 aa AA seqDB search
MPLPAARSGSGRSSMSWFSGLLVPKVDERKTAWGERNGQKRPRHGTRAGGFCTPRYMSCL
KDAEPPSPTPAAHTRCPWQDEAFLRRAGPGRGMELGLRSVALGFDDTEVTTPVGTAEVAP
DTSPRSSHSCWHRLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLA
FHAAPAPPQPAYVALLTCAATLFVALMILCNRHSFRQDSMWVVSYVVLGILAAVQVGGAL
AANPRSPSAGLWCPVFFVYITYTLLPIRMRAAVLSGLGLSALHLILAWQLNRDDPFLWNQ
LGANVVLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQ
HVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELF
ARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVN
VNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDY
EVEPGRGGERNAYLKEQCIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWAPDR
AFSRTKDSKAFRQMGIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRF
LLTFQRQDLEKKYSRKVDPRFGAYVACAFLVFCFICFIQLLIFPHSTMMLGIYVSIFLLL
LVTVLICAVCSCGSLFPKALQRLSRSIVRSRAHSTAVGTFSVLLVFISAIANMFTCNHTP
IRTCAARMLNLTPADVTACHLQQLNYSLGLDAPLCEGAAPTCSFPEYFVGNVLLSLLASS
VFLHISSIGKLAMTFVLGFIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLNCPA
VGRVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLL
HNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLL
NEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLME
QMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQV
TTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcccgcggcccgatccggttctgggcgcagcagcatgtcatggtttagtggc
ctcctggttcccaaagtggatgaacggaagacagcttggggagaacgcaacgggcagaag
cgcccacgccatgggactcgggccggtggcttctgcacaccccgctacatgagctgtctg
aaggatgcagagccacccagccccactcctgcggctcacactcggtgcccctggcaggat
gaggccttcctcaggagggctggcccaggcaggggcatggagctggggctgcggtcagtg
gccttgggttttgatgacactgaggtgacaacaccagtggggacagctgaagtggcacct
gatacatcgcctaggagcagtcactcctgctggcaccgtctggtgcaggttttccagtct
aagcagttccgctctgccaagctggagcgtctgtaccagcggtacttcttccagatgaac
cagagcagcctcacgctcctcatggcggtgctcgtgttactcacagctgtgctcttggct
ttccacgctgcacctgccccgcctcagcctgcttatgtggccctgctgacctgtgccgcc
accctgtttgtggcactcatgatactgtgtaaccgacacagctttcgccaggactccatg
tgggtggtgagctatgtggttctgggcatcctagcagctgtgcaagtcgggggtgccctg
gcagccaacccacgcagcccctcagcaggcctttggtgccctgtgttctttgtctacatc
acctacacgcttcttcccatccgcatgcgagccgcagtgctcagtggcctgggcctttcc
gccttgcatttgattttggcctggcagctcaaccgtgatgaccccttcctctggaatcag
ctcggtgctaatgtggtgctctttctctgcaccaatgtcatcggcatctgcacacactac
cctgctgaagtgtctcagcgccaagcctttcaggagacccgaggttacatccaggcccgg
ttgcacttgcagcatgagaatcgccagcaggaacggctgctgctatcggtgttgccccag
catgttgccatggagatgaaagaagacatcaacacaaaaaaagaagacatgatgttccat
aagatctacatccagaagcatgataatgtcagcatcctatttgcggacatcgagggcttc
accagcctggcctcccagtgcactgcgcaggaactggtcatgaccttgaatgagctcttt
gcccggtttgacaagctggctgcggagaaccactgtctgaggatcaagatcctaggggac
tgttactactgtgtgtcggggctgcccgaggcccgggcagaccacgcccactgctgtgtg
gagatgggagtggacatgatcgaggccatctcgctggtgcgtgaagtgacaggtgtaaat
gtaaacatgcgtgtgggcatccacagtggacgcgtgcactgcggtgtccttggcctgcgg
aaatggcagtttgatgtatggtccaacgatgtgaccctggccaaccacatggaggctggg
ggccgagctggtcgcatccacatcactcgggccacactgcagtacctgaatggggactat
gaggtggaaccaggccgtggtggtgagcgcaacgcgtacctcaaggagcagtgtatcgag
actttcctcatcctgggcgccagccagaaacggaaagaggagaaagctatgctggccaag
ctgcagcggacacgggccaactccatggaaggactgatgccacgctgggcgcctgaccgt
gctttctcccggaccaaggactctaaggcattccgccagatgggcattgacgattctagc
aaagacaaccgtggtgcccaagatgctctgaaccctgaagatgaggtggacgagttcctg
ggccgtgccattgatgcccgtagcatcgaccaactgcgtaaggaccacgtgcgccggttc
ctgctcaccttccagagacaggatcttgagaagaagtattcacggaaagtagatcctcgc
tttggagcctatgtcgcctgtgcctttttggttttttgcttcatttgtttcatccagctc
ctcatatttccacactctaccatgatgcttgggatctatgtcagtatcttcctgctgttg
ctggtcactgtgctgatctgtgctgtgtgctcctgtggttctctcttccccaaggccttg
caacgtctgtcccgcagtattgtccgctcacgagcacacagcacagcagttggcaccttt
tcagttctgcttgtgttcatctctgccattgccaacatgttcacctgtaatcacacccca
ataaggacctgcgcagcccgcatgctgaatttaacaccagctgatgtcactgcctgccac
ctgcaacagctcaattactctctgggactggatgctcccctgtgtgagggcgccgcaccc
acctgcagcttccctgagtacttcgtcgggaatgtgctgctgagtcttttggccagctct
gtcttcctgcatatcagcagcatcggcaagctggctatgacctttgtcttggggttcatc
tatttggtgctgcttttgctgggtcccccggccaccatctttgacaactatgatctactg
cttggtgtccatggcttggcttcctccaatgagacctttgatgggctgaactgcccagct
gtagggagggtggcactcaaatatatgacccctgtgattctgctggtctttgccctggca
ctgtatctacatgcacagcaggtggaatcaactgcccgcctggacttcctctggaaactg
caggcaacaggggagaaggaagagatggaggagctccaggcatacaaccgacggttgctg
cataacattctgcccaaggacgtggctgcccacttcctggcccgagaacgccgcaacgat
gagctctactaccagtcatgtgaatgtgtggctgttatgtttgcctccattgccaacttc
tctgaattctatgtggaacttgaggcaaacaatgagggtgtcgagtgccttcggctgctc
aatgagatcatcgccgactttgatgagatcatcagtgaggagagattccggcagctggag
aagatcaagacaattggcagcacctacatggctgcctctgggctaaatgccagcacctat
gatcaggtgggccgttcccacatcactgccctggcagactatgccatgaggctcatggag
cagatgaaacatatcaacgaacactctttcaacaatttccagatgaagattggactgaac
atgggtccagttgtggccggtgtcattggggcccggaagccacagtatgacatctgggga
aatacagtgaacgtctccagtcgtatggacagcacaggggttcctgaccgaatacaggtg
accacggacctataccaggttctagctgccaagggctaccaactggagtgccgaggggtg
gtcaaggtgaagggcaagggggagatgaccacttacttcctcaatgggggccctagcagt
tag

KEGG   Cricetulus griseus (Chinese hamster): 100768998Help
Entry
100768998         CDS       T02813                                 

Gene name
Adcy4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04742  Taste transduction
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100768998 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100768998 (Adcy4)
   04371 Apelin signaling pathway
    100768998 (Adcy4)
   04020 Calcium signaling pathway
    100768998 (Adcy4)
   04072 Phospholipase D signaling pathway
    100768998 (Adcy4)
   04024 cAMP signaling pathway
    100768998 (Adcy4)
   04022 cGMP-PKG signaling pathway
    100768998 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100768998 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100768998 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100768998 (Adcy4)
   04062 Chemokine signaling pathway
    100768998 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    100768998 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    100768998 (Adcy4)
   04912 GnRH signaling pathway
    100768998 (Adcy4)
   04913 Ovarian steroidogenesis
    100768998 (Adcy4)
   04915 Estrogen signaling pathway
    100768998 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    100768998 (Adcy4)
   04921 Oxytocin signaling pathway
    100768998 (Adcy4)
   04926 Relaxin signaling pathway
    100768998 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    100768998 (Adcy4)
   04918 Thyroid hormone synthesis
    100768998 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    100768998 (Adcy4)
   04916 Melanogenesis
    100768998 (Adcy4)
   04925 Aldosterone synthesis and secretion
    100768998 (Adcy4)
   04927 Cortisol synthesis and secretion
    100768998 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100768998 (Adcy4)
   04270 Vascular smooth muscle contraction
    100768998 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    100768998 (Adcy4)
   04971 Gastric acid secretion
    100768998 (Adcy4)
   04972 Pancreatic secretion
    100768998 (Adcy4)
   04976 Bile secretion
    100768998 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100768998 (Adcy4)
   04727 GABAergic synapse
    100768998 (Adcy4)
   04725 Cholinergic synapse
    100768998 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    100768998 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    100768998 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    100768998 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    100768998 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    100768998 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100768998 (Adcy4)
   04714 Thermogenesis
    100768998 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768998 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    100768998 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100768998 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100768998 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100768998 (Adcy4)
   05163 Human cytomegalovirus infection
    100768998 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100768998 (Adcy4)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100768998 (Adcy4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Motif
Other DBs
NCBI-GeneID: 100768998
NCBI-ProteinID: XP_027246330
Position
1
AA seq 1072 aa AA seqDB search
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLIIVLCTLVALPAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQQLQRWTRPLSGLIWAALLALGHGFLFTGGVVSAWDQV
SFFLFIIFTVYSMLPLGMRDAAIAGLISSLSHLLVLGLYLGWQPDPQRALLPQLAANAVL
FLCGNVVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAVQVSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKDHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRVATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
VYAVERADMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAKGLLSSLEGHKMRPSLLMTR
YLESWGAAKPFAHLSHVDSFVCTSTPLPEKAFSPQWSLDRSRTPRGLDEELDTGDAKFFQ
VIEQLNSQKQWKQSKDFNLLTLYFRDNEMEKQYRLSALPAFKYYAACTFLVFLSNFAIQM
LVTNRPPALAITYSITFLLFLLLLFVCFSEHLTKCVQKGPKLLHWLPALSVLVTTRPGLR
VALGTATILLVFTMAIASLLFLPVSSDCLFLASNASSMAFNASWELPGSLPLISIPYSMH
CCVLGFLSCSVFLHMSFELKLLLLLLWLVASCSLFLHSHALLSDCLIAHLYPSPLDSRPG
VLKEPKLMGAIYFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLE
NVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLN
EIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDADRSCSHLGTMVEFA
VALGSKLDIINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVL
GKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGSPSAP
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgccccccagcgaagatctcttctacgagacctac
tacagcctgagccaacagtacccactgctactactgcttctgatcatcgtgctctgcacg
ctcgtggcactgccagccgtcgcctgggccagcggcagggagctgacctcagacccaagc
ttcctgacaaccgtgctgtgtgctttgggtggcttctctctgctgttgggactggcttcc
cgggagcagcaactgcagcgctggacacgacctctttccggcctcatatgggctgcactg
ctggctctaggccatggatttctgttcactgggggtgtggtgagcgcctgggaccaggtg
tcatttttcctcttcatcatcttcactgtgtattccatgttgcccttggggatgcgggat
gctgctattgcaggcctcatctcatcactctcgcatctgctggtccttggactctacctt
gggtggcagcctgatccacagagggctctgctaccacagttggcagcaaacgcggtcttg
ttcctgtgtgggaatgtggtgggagcataccacaaggccttgatggagagagcattgcgc
gccacattccgggaggctctcagctctctgcactcacgccggaggctggacactgagaaa
aagcatcaggagcacctccttttgtccatccttcctgcctacctggcccgagagatgaaa
gccgagatcatggcacggctgcaggctgtgcaggtgtcacggccggagaacacgaacaac
tttcacagcctgtatgtcaagaggcaccaaggagtcagtgtgctgtatgctgacatcgtg
ggcttcactcggctggccagtgagtgttcccctaaagaactggtgctcatgctcaatgag
ctcttcggcaagttcgaccagattgccaaggaccacgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctcggggctgccactctcactgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgtcgggccatcaggaaacttcgggtagccactggt
gtggacatcaacatgcgtgtgggtgtgcactcgggcagtgtgctctgtggagtcatcggg
cttcagaagtggcagtatgatgtctggtcccatgatgtcacattggctaaccacatggaa
gctggtggcgtgccaggacgagtacacatcacaggggctactctggccctgttagcaggg
gtttatgctgtggagagagcagacatggaacaccgagacccataccttcgggagctaggc
gaacctacgtacctggtcatcgatccccgggctgaggaggaagatgagaagggcactgct
aaaggattactgtcttctttggaggggcacaagatgcgtccatcactactgatgactcgt
tatctggagtcttggggtgcagccaaacctttcgcccacttaagccacgttgacagtttt
gtatgcacctccactccactcccggaaaaggccttcagcccccagtggagcctggaccgg
agtcgcaccccacggggactagatgaagaactggacactggggatgccaagttcttccag
gtcatcgagcaactcaattctcaaaaacagtggaagcagtcgaaggacttcaacctcctg
acactgtacttcagagacaacgagatggagaaacagtatcggctctctgcactccccgcc
ttcaaatactatgcagcctgcaccttcctggtttttctgtccaacttcgctatccaaatg
ctggtgacaaacaggcccccagctctggccatcacctatagcatcaccttcctcctcttc
cttctcctcctcttcgtctgcttctcagaacacttgacgaagtgtgtccagaaaggtccc
aaactgttgcactggctgcctgcactgtctgtcctggtgactacacggccaggacttcga
gtagccctgggcactgccactatcctcctggtgttcaccatggccatcgccagcctgctc
ttcttgccagtgtcatcagactgccttttcctggcttccaatgcctcgtccatggctttc
aatgcttcctgggagctgccaggatccctgcctctcatcagtatcccatactccatgcat
tgctgcgtgctgggtttcctctcctgttccgtttttctgcacatgagctttgaactgaaa
ctcctgctgcttctgctgtggctggtggcatcctgttccctgtttctgcactcacatgcc
ttgctgtccgactgcctcatcgcccacctctatccaagtcctttggactccaggccaggg
gtgctgaaggaacccaaactgatgggtgccatctacttcttcatcttcttcttcacgctc
cttgtcctggctcggcagaatgagtattactgccgcctggacttcctgtggaagaagaag
ctgaggcaggagcgagaggagactgagacgatggagaacctgactcggctcctcctggag
aatgtactcccagcacatgtggccccccagttcattggccagaaccggcgcaatgaggac
ctctaccaccagtcctacgaatgtgtgtgtgtcctctttgcatcggtgccggactttaag
gaattctactctgaatctaacatcaaccatgaaggactggagtgtctgcggctgctcaat
gagataattgctgattttgacgagctgctctccaagccgaagttcagtggagtagagaaa
atcaaaactattggcagcacctacatggcagccacaggcttgaatgccacctctggacaa
gacacacagcaggatgccgatcgaagctgcagccatctgggcaccatggtggaatttgca
gtggccctgggatctaagctggatatcatcaataagcactcattcaacaacttccgcctg
cgtgtggggttgaaccacggaccagtcgtagcaggagtgattggggcacagaagccacaa
tatgacatctgggggaacacagtgaatgtggccagccgcatggagagtacaggagttctt
ggcaagatccaagtgactgaggagacagctagagccctgcaatccctgggttatacatgc
tacagccggggtgtcatcaaggtcaaaggcaaaggacaactttgtacctacttcttgaac
acagacctgacaagaaccggatctccctcagccccctag

KEGG   Cricetulus griseus (Chinese hamster): 100770498Help
Entry
100770498         CDS       T02813                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04740  Olfactory transduction
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04962  Vasopressin-regulated water reabsorption
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100770498 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100770498 (Adcy3)
   04371 Apelin signaling pathway
    100770498 (Adcy3)
   04020 Calcium signaling pathway
    100770498 (Adcy3)
   04072 Phospholipase D signaling pathway
    100770498 (Adcy3)
   04024 cAMP signaling pathway
    100770498 (Adcy3)
   04022 cGMP-PKG signaling pathway
    100770498 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100770498 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100770498 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100770498 (Adcy3)
   04062 Chemokine signaling pathway
    100770498 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    100770498 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    100770498 (Adcy3)
   04912 GnRH signaling pathway
    100770498 (Adcy3)
   04913 Ovarian steroidogenesis
    100770498 (Adcy3)
   04915 Estrogen signaling pathway
    100770498 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    100770498 (Adcy3)
   04921 Oxytocin signaling pathway
    100770498 (Adcy3)
   04926 Relaxin signaling pathway
    100770498 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    100770498 (Adcy3)
   04918 Thyroid hormone synthesis
    100770498 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    100770498 (Adcy3)
   04916 Melanogenesis
    100770498 (Adcy3)
   04925 Aldosterone synthesis and secretion
    100770498 (Adcy3)
   04927 Cortisol synthesis and secretion
    100770498 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100770498 (Adcy3)
   04270 Vascular smooth muscle contraction
    100770498 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    100770498 (Adcy3)
   04971 Gastric acid secretion
    100770498 (Adcy3)
   04972 Pancreatic secretion
    100770498 (Adcy3)
   04976 Bile secretion
    100770498 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100770498 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100770498 (Adcy3)
   04727 GABAergic synapse
    100770498 (Adcy3)
   04725 Cholinergic synapse
    100770498 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    100770498 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    100770498 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    100770498 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    100770498 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    100770498 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100770498 (Adcy3)
   04714 Thermogenesis
    100770498 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100770498 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    100770498 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100770498 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100770498 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100770498 (Adcy3)
   05163 Human cytomegalovirus infection
    100770498 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100770498 (Adcy3)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100770498 (Adcy3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N fn3_4
Motif
Other DBs
NCBI-GeneID: 100770498
NCBI-ProteinID: XP_027280355
Position
7
AA seq 1145 aa AA seqDB search
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGIGLVLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLITAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELQGMQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAQNGLNGSALPNGAPASSKPSSPALIETKEPNGSAHAS
GSTSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNY
VTFVVGEVLLLILTICSLAAIFPRAFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMANV
VDMLSCLQYYMGPYNVTAGMELDGGCMENPKYYNYVAVLSLIATIMLVQVSHMVKLTLML
LVTGAVTAINLYAWSPVFDEYDHKRFQEQDSPVVALEKMQVLSAPGLNGTDSRPPLVPSK
YSMTVMMFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQ
VVDNS
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcagatcccgagtactcggcagaatactcagccgagtac
tcggtcagcctgccctctgaccccgaccgtggggttggccggacccatgaaatttctgtg
cggaactcggggtcctgcctgtgcctgcctcgctttatgcggctgacctttgtgcctgag
tccttggagaacctctaccagacctacttcaaaaggcagcgtcatgagacactgctggtg
ctggtggtctttgcggccctctttgactgctacgtggtggtcatgtgcgcagtggtcttc
tccagcgacaagttggcgcccctcatggtggctggcattggtctggtgttggacatcatc
ctctttgtgctctgcaaaaaggggctgctcccggatcgagtgagccgcaaagtggtaccc
tacctgctgtggctgctcatcacagcccagatcttctcatacctgggcctgaacttttca
cgtgcccacgcagccagcgacacggtgggttggcaggccttctttgtcttctccttcttc
attacgctgcccctcagcctcagccccatcgtgatcatctctgtggtctcctgcgttgtg
cacacgctcgtcttgggggtcactgtggcccagcagcagcaagatgagctgcaagggatg
cagctgctgagggagatcctggccaatgtcttcctctacctgtgtgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacttggaggagcagagccagcagcaggagaaccttatgctt
tcgatcctgccaaagcatgtggctgacgagatgttgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcatgagaatgtcagcatc
ctgtttgcagatattgtgggctttacccagttgtcctccgcctgcagcgcccaggagctc
gtaaagctactcaatgagctttttgcccgctttgacaagctggcggctaaataccaccag
ctgaggatcaagatcctgggtgactgttactactgcatctgcggcctgcctgactaccgg
gaggaccatgccgtgtgctccatactcatggggcttgccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggcgtggacatgcgtgtgggggtgcacacaggcactgtg
ctaggcggtgtcctaggccagaagcgttggcagtatgacgtgtggtctaccgatgtcact
gtggctaacaagatggaggctggtggcatcccagggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtagagcctggcgatgggggcagtcgctgtgac
tacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagctcaaaatggcctcaatggctcggccctgccaaatggcgcaccggcatcctcc
aagcccagctccccggcccttattgagaccaaggagcccaatgggagcgcccatgccagt
gggtccacatcagaggaggcagaagagcaggaggcccaggccgacaacccctcgttcccc
aacccccgccgcaggctgcgccttcaggacctggcagaccgtgtagtagatgcctctgag
gatgagcatgaactgaaccagctgctcaacgaggccctgctggagcgggaatctgcccag
gtggtgaagaagagaaatacattcctcctaaccatgcggttcatggacccagagatggaa
acacgctactcggtggagaaggagaagcagagtggggcggccttcagctgctcctgtgtg
gtcctcttctgcacggccatggtggagatacttattgacccctggctgatgacaaactac
gtgaccttcgtggttggggaggttctcctcttgatcctgaccatctgctcgctggccgcc
atctttcccagggcatttcctaagaagcttgtggccttctcatcttggattgaccgaact
cgctgggccaggaacacctgggccatgttagccatcttcattctggttatggccaatgtt
gtggacatgcttagctgtctccagtactacatgggaccttacaatgtgacagccgggatg
gagctggatggcggctgtatggagaaccccaagtactacaactatgtggctgtgctgtcc
ctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagttgacgctcatgctg
ctcgtcacgggcgcagtgactgccatcaacctgtatgcctggagtcccgtcttcgatgaa
tatgaccacaagcgctttcaggaacaggactctcctgtggtggccttagagaagatgcag
gtgttgtctgcccctgggctcaatggcactgacagcaggccacccctggtgccttccaag
tactcgatgactgtgatgatgttcgtcatgatgctgagcttttactatttctcccgccac
gtggaaaaactggcgcgaacgctcttcctgtggaagattgaggtccatgaccagaaagaa
cgtgtctatgagatgcggcgatggaatgaggccttggtcaccaacatgttgcctgagcat
gttgcacgccatttcctggggtccaagaagagagatgaggaactgtacagtcagtcttac
gacgagattggagtcatgtttgcctccttgcccaactttgctgacttctacactgaggag
agcatcaacaatggtggtatcgaatgtctacgattcctcaatgagatcatctctgacttt
gactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccattggcagc
acctatatggcagcttcaggggtcaccccagatgtcaacaccaatggctttacaagctcc
agcaaggaggagaagtcagacaaggagcgctggcagcacctggccgacctggccgacttt
gcattagccatgaaggatacgctcaccaacatcaacaaccagtcattcaacaacttcatg
ttgcgcataggcatgaacaaaggcggggttctggctggagtcattggagcccgaaaacca
cactatgacatctggggcaacacagtcaatgtggccagcaggatggaatccacaggggtc
atgggcaacatccaggtggtagaagaaacgcaggtcatccttcgagagtatggcttccgc
tttgtgaggcgaggccccatctttgtgaaagggaaaggggagctcctgacctttttcttg
aaggggcgggacaggccagctgccttccccaatggctcctctgttaccctgccccaccaa
gtggtggacaactcctga

KEGG   Cricetulus griseus (Chinese hamster): 100773811Help
Entry
100773811         CDS       T02813                                 

Gene name
Adcy2
Definition
(RefSeq) adenylate cyclase type 2 isoform X2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100773811 (Adcy2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100773811 (Adcy2)
   04371 Apelin signaling pathway
    100773811 (Adcy2)
   04020 Calcium signaling pathway
    100773811 (Adcy2)
   04072 Phospholipase D signaling pathway
    100773811 (Adcy2)
   04024 cAMP signaling pathway
    100773811 (Adcy2)
   04022 cGMP-PKG signaling pathway
    100773811 (Adcy2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100773811 (Adcy2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100773811 (Adcy2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100773811 (Adcy2)
   04062 Chemokine signaling pathway
    100773811 (Adcy2)
  09152 Endocrine system
   04911 Insulin secretion
    100773811 (Adcy2)
   04922 Glucagon signaling pathway
    100773811 (Adcy2)
   04923 Regulation of lipolysis in adipocytes
    100773811 (Adcy2)
   04912 GnRH signaling pathway
    100773811 (Adcy2)
   04913 Ovarian steroidogenesis
    100773811 (Adcy2)
   04915 Estrogen signaling pathway
    100773811 (Adcy2)
   04914 Progesterone-mediated oocyte maturation
    100773811 (Adcy2)
   04921 Oxytocin signaling pathway
    100773811 (Adcy2)
   04926 Relaxin signaling pathway
    100773811 (Adcy2)
   04935 Growth hormone synthesis, secretion and action
    100773811 (Adcy2)
   04918 Thyroid hormone synthesis
    100773811 (Adcy2)
   04928 Parathyroid hormone synthesis, secretion and action
    100773811 (Adcy2)
   04916 Melanogenesis
    100773811 (Adcy2)
   04925 Aldosterone synthesis and secretion
    100773811 (Adcy2)
   04927 Cortisol synthesis and secretion
    100773811 (Adcy2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100773811 (Adcy2)
   04270 Vascular smooth muscle contraction
    100773811 (Adcy2)
  09154 Digestive system
   04970 Salivary secretion
    100773811 (Adcy2)
   04971 Gastric acid secretion
    100773811 (Adcy2)
   04972 Pancreatic secretion
    100773811 (Adcy2)
   04976 Bile secretion
    100773811 (Adcy2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100773811 (Adcy2)
   04727 GABAergic synapse
    100773811 (Adcy2)
   04725 Cholinergic synapse
    100773811 (Adcy2)
   04723 Retrograde endocannabinoid signaling
    100773811 (Adcy2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100773811 (Adcy2)
  09149 Aging
   04211 Longevity regulating pathway
    100773811 (Adcy2)
   04213 Longevity regulating pathway - multiple species
    100773811 (Adcy2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100773811 (Adcy2)
   04714 Thermogenesis
    100773811 (Adcy2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100773811 (Adcy2)
  09165 Substance dependence
   05032 Morphine addiction
    100773811 (Adcy2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100773811 (Adcy2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100773811 (Adcy2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100773811 (Adcy2)
   05163 Human cytomegalovirus infection
    100773811 (Adcy2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100773811 (Adcy2)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100773811 (Adcy2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA DUF349
Motif
Other DBs
NCBI-GeneID: 100773811
NCBI-ProteinID: XP_027255918
Position
2
AA seq 1095 aa AA seqDB search
MWQEAMRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMG
ACLALLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSVVIWIC
LVAMGYLFMCFGGTVSAWDQVSFFLFIIFVVYTMLPFNMRDAVIASVLTSSSHTIVLSVY
LSATPGAKEHLSWQILANVIIFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFE
KRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADI
VGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAK
NCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHM
EAGGVPGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQHL
FRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQ
NRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKNIEKEYRATA
LPAFKYYVTCACLIFLCIFIVQILVLPKTSTLGLSFGAAFLSLIFILFVCFAGQLLQCSK
KASASLMWLLKSSGIIANRPWPRISLTIVTTTIILTMAVFNMFFLSDSEETALPTANMSN
ANFSVSENQAAILRARSLFFLPYFIYSCVLGLIACSVFLRVNYELKMLIMMVALVGYNTI
LLHTHAHILDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLVLGRQSEYYCRLDFLWKN
KFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDF
KEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPS
QEHAQEPERQYMHIGTMVEFAYALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKP
QYDIWGNTVNVASRMDSTGVLDKIQVTEETSVILQTLGYTCTCRGIINVKGKGDLKTYFV
NTEMSRSLSQSNLAS
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaggctatgcggcggcgccgctacctgcgggaccgcgccgaggcggcggcg
gcagcggcggcgggtggcggcgaggggctgcagaggtcccgggactggctctacgagtcc
tactactgcatgagccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggc
gcctgcctcgccctgctagccgtcttcttcgccctcgggctggaagtagaagaccatgtg
gcatttttaataacagttcccactgccctggcaattttctttgccatattcatccttgtc
tgcatcgagtctgtgttcaagaagctgctccgcgtgttctcggtggtgatttggatatgt
ctggttgccatgggatacctgttcatgtgctttggaggtaccgtgtctgcctgggaccag
gtgtcgttcttcctctttatcatctttgtggtgtacaccatgcttcccttcaacatgcga
gatgccgtcattgccagcgtcctcacctcctcatcccacaccatagtactgagtgtctac
ctgtctgcgaccccaggagccaaggagcacctgtcctggcagatcctggccaatgtgatc
attttcatctgtgggaacttggcaggagcctaccacaagcacctcatggaacttgccctg
cagcaaacctaccgggacacatgtaattgcatcaagtcccggatcaagctggagtttgaa
aaacggcagcaggagcggcttctactttccttgctgccggctcacatagccatggagatg
aaggctgagatcatccagaggctgcagggccccaaggcaggccagatggaaaacactaac
aactttcataacctgtatgtcaaacggcacaccaacgtgagcatcttatacgctgacatc
gttgggttcacccgtcttgcaagtgactgctcccctggggaactggtccacatgctgaat
gaactcttcgggaagtttgaccaaatcgcaaaggagaacgaatgcatgagaattaaaatt
ttaggagactgctattactgtgtttccggactccctatatctctccctaaccatgccaag
aactgtgtgaaaatgggattggatatgtgtgaagccataaagaaagtgagggatgctaca
ggggttgatatcaacatgcgtgtaggagtgcattctgggaatgtcctgtgtggcgtgatt
ggtctccagaagtggcagtatgatgtatggtctcatgacgttactttggccaaccacatg
gaagctggaggagtccccgggcgtgttcacatttcttcagtcactctggagcacttgaat
ggggcttacaaagtggaggaaggagacggtgaaataagagacccatatttaaaacagcac
ttggtgaaaacctacttcgtaatcaaccccaagggagagcgacggagcccccagcacctc
ttcagacctcgccacaccctagatggagccaagatgagagcatctgttcgcatgacccgc
tacttggagtcctggggagcagccaagccctttgcgcatctgcaccacagggacagtatg
accacagagaacgggaagattagcaccacggatgtgccaatggggcagcataattttcaa
aaccgcaccttaagaaccaagtcgcagaagaaaagattcgaagaggagctgaatgaaagg
atgatccaagcaattgatgggatcaacgcacaaaagcaatggctcaagtctgaagacatt
cagagaatctccctgcttttctataacaagaatatagaaaaagaataccgagccaccgca
ctgccagcattcaagtactatgtgacctgcgcctgcctcatctttctctgcatcttcatc
gtacagattcttgtgttgccaaaaacgtccacccttggcctctccttcggagctgcgttt
ctctccctcatcttcatcctctttgtctgcttcgctggacagcttttgcaatgtagcaag
aaagcctctgcctctctcatgtggcttctgaaatcatcaggcatcatcgccaaccgccca
tggccacggatctccctcacgattgtcaccacaaccatcatactaaccatggctgtgttc
aacatgtttttcctgagtgactctgaggagacagcccttccaactgccaatatgtcaaat
gcaaacttttctgtctcagaaaaccaggcagcgattctccgtgctcgaagcttgtttttc
ctcccgtacttcatatacagctgtgtcctgggcttgatcgcctgctctgttttcctgagg
gtgaactacgagttaaaaatgttgatcatgatggtggcacttgtgggctacaacaccatt
ttgctccacacccacgcccacatcctggatgcgtacagccaggtcctgtttcagagacca
ggcatttggaaagacctgaagaccatgggctccgtgtccctctctatattcttcatcaca
ctgctcgttctgggtagacagagtgaatattactgtaggttagacttcttatggaagaac
aaattcaaaaaagagcgggaggagatagaaaccatggagaacctgaaccgagtgctgctg
gagaacgtgcttcccgcgcatgtggctgaacacttcctggccaggagcctgaagaacgag
gagctttaccaccagtcctatgattgtgtctgtgtcatgttcgcttccattccggacttc
aaggaattctacacagaatcggatgtgaacaaggagggcctggaatgccttcggctcctg
aatgagatcattgctgactttgatgatctgctttccaagccaaagttcagtggtgttgaa
aagatcaagaccatcggtagcacatacatggcagccacgggtctgagtgctgtaccaagc
caggagcatgcccaggagcctgagcgtcagtacatgcacataggcaccatggtggagttt
gcatatgccctagtggcaaaactggatgccatcaataaacactccttcaacgacttcaaa
ctgcgagtgggtatcaatcatggacctgtaatagccggtgtcataggagctcagaagcca
caatatgacatctggggcaatactgtcaatgtcgccagcaggatggacagcactggggtc
ctggacaaaatacaggtgactgaggagacaagcgtcatcctgcagacacttggctacaca
tgcacgtgtcgaggcatcatcaatgtgaaggggaagggggacctgaagacgtactttgta
aacacagagatgtcaaggtccctttctcagagcaacttggcatcctga

KEGG   Cricetulus griseus (Chinese hamster): 113837458Help
Entry
113837458         CDS       T02813                                 

Definition
(RefSeq) adenylate cyclase type 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04742  Taste transduction
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113837458
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113837458
   04371 Apelin signaling pathway
    113837458
   04020 Calcium signaling pathway
    113837458
   04072 Phospholipase D signaling pathway
    113837458
   04024 cAMP signaling pathway
    113837458
   04022 cGMP-PKG signaling pathway
    113837458
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113837458
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113837458
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113837458
   04062 Chemokine signaling pathway
    113837458
  09152 Endocrine system
   04911 Insulin secretion
    113837458
   04923 Regulation of lipolysis in adipocytes
    113837458
   04912 GnRH signaling pathway
    113837458
   04913 Ovarian steroidogenesis
    113837458
   04915 Estrogen signaling pathway
    113837458
   04914 Progesterone-mediated oocyte maturation
    113837458
   04921 Oxytocin signaling pathway
    113837458
   04926 Relaxin signaling pathway
    113837458
   04935 Growth hormone synthesis, secretion and action
    113837458
   04918 Thyroid hormone synthesis
    113837458
   04928 Parathyroid hormone synthesis, secretion and action
    113837458
   04916 Melanogenesis
    113837458
   04925 Aldosterone synthesis and secretion
    113837458
   04927 Cortisol synthesis and secretion
    113837458
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113837458
   04270 Vascular smooth muscle contraction
    113837458
  09154 Digestive system
   04970 Salivary secretion
    113837458
   04971 Gastric acid secretion
    113837458
   04972 Pancreatic secretion
    113837458
   04976 Bile secretion
    113837458
  09156 Nervous system
   04724 Glutamatergic synapse
    113837458
   04727 GABAergic synapse
    113837458
   04725 Cholinergic synapse
    113837458
   04720 Long-term potentiation
    113837458
   04723 Retrograde endocannabinoid signaling
    113837458
  09157 Sensory system
   04742 Taste transduction
    113837458
   04750 Inflammatory mediator regulation of TRP channels
    113837458
  09149 Aging
   04211 Longevity regulating pathway
    113837458
   04213 Longevity regulating pathway - multiple species
    113837458
  09159 Environmental adaptation
   04713 Circadian entrainment
    113837458
   04714 Thermogenesis
    113837458
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113837458
  09165 Substance dependence
   05032 Morphine addiction
    113837458
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    113837458
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113837458
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113837458
   05163 Human cytomegalovirus infection
    113837458
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113837458
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113837458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 113837458
NCBI-ProteinID: XP_027287368
Position
10
AA seq 1600 aa AA seqDB search
MAWPGPLGFHGTPQEVGGVRKRPEPDVISHQLTVFRTRALLAAAAVALAEVMDGHLDFHH
LQPGSRLALLSCPCCTAGVRGQNGLRSWLCTCQGQEPVLKKEPRRNQQQERPAGALTAAR
SQAQGCRPSRSPDPPVQAFKTWGILYRSGRRRVPAPTPLIHPPPIPGSGGVVWSGGGFKS
SRVSDRSDRSPNSSQAPVPLRGSERPSGTALPWIRGRFIGFHSAWSLSSRPNLSPAASPA
KARFSGSGIGASGFSSYSAVGFAALATCSFPTTPSVRAGPMDSKERSEGDGNCVLRPHRI
APRSLSAERGLRGSERREFRRQIATAVTAYPSCADWREGGSPGLKGPLPSARSPSLGGDY
DLTRGGPAQGSCNRAAEGRSDRCQAGLRVFRSPHPQLPPPVSPPASLRTRAMELSDVHCL
SGSEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGGGSRKASNPA
GSGPNHHAPQLSGDSALPLYSLGPGERAHNTGGTKVFPERSGSGSASGSGGGGDLGFLHL
DCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSEVVMNVLDVLT
KLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVVCALVVVRKETTSHTYLQYSGVVTWVA
MTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLSTSLLQVTLQVLIPR
LAVFSINQVLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQER
LVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSA
QELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLGMIKT
IRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHIS
KATLDCLNGDYSVEEGHGKERNEFLRKHNIETYLIKQPEETLLSLPEDIVKESVSSSDRR
NSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIE
HTIDLRSGDKLRRVHIKPFSLTFKDSSLEHKCVSCRLVPMTIQFSILIMMHSALVLVTTA
EDYKCLPLVLRKTCCWINETYLARNVIIFASILINFLGAVLNIYFVFTGVLAMVTCAVFL
RLNSVLKLAVLLIMIAVYALLTETVYAGLFLSYDNLNHSGEDFLGTKEASLLLMAMFLLA
VFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNE
ELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIE
KIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGI
SHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRG
EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSLNRQRQKQL
LNENSNSGIIKGHYNRRTLLTPSGPEPGAQAEGTDKSDLP
NT seq 4803 nt NT seq  +upstreamnt  +downstreamnt
atggcttggccaggtcctttaggctttcatgggacgccacaggaggtggggggagtgcga
aagcgcccagagcctgacgtcattagccatcagctgactgtgttcaggacccgggcttta
ttggctgcagccgcagtcgcgctggcagaggtgatggatggccacctagacttccaccac
ctgcagccgggttccagactggcactactatcctgtccctgctgcactgctggagttcgt
gggcaaaacggcctacgatcctggctctgcacctgccaaggacaggagccagtgcttaaa
aaagaaccgcggaggaaccagcagcaggagcggccagctggagcgctcaccgcagcgcgc
agccaggcccagggctgtcgcccgtcgcgctcgcccgatccaccggtgcaggccttcaaa
acctggggcatcctgtacagatctgggcgccgccgtgtcccagcccccacacctcttatc
caccccccccccattccgggttccgggggcgtggtttggagtgggggcgggtttaagtcg
tcgcgggtgtctgaccgctctgacaggtctccaaattcctcccaggctccggtcccgcta
cgtggttcagagcgcccgagtggcaccgcgcttccctggatccgggggcgtttcatcggc
ttccactcggcctggagcctctcatctcgcccaaatctttcgcctgctgcctcgcccgcc
aaggctcggttctcgggttcaggaatcggcgccagtggcttctcttcctactcagctgtt
ggctttgcagccctagccacttgttctttccccacaaccccctcggtccgggctggccca
atggactctaaagagcgaagtgaaggggatgggaattgtgtgctgcgaccccacagaatc
gctccaaggagcttgagcgccgaaaggggactgcgtggctcagagcgccgagaatttcgc
agacaaatagccaccgctgtcactgcgtatccaagctgtgctgattggcgggaaggtggc
tcgccaggactcaagggtccgctgccatctgccaggagtccctctctcgggggagactat
gacctgacccgtgggggccctgctcagggctcctgcaatcgagcagccgagggaagaagt
gatcgctgccaagccggccttcgggtctttaggagcccccacccccaactgccaccacca
gtttctccgcctgcctctctgcggacccgagccatggagctctcggatgtgcactgcctg
agtggcagcgaggaactctacaccatccacccgacgcccccggccggcgacggcgggagc
ggttcccggccgcagcggctgctgtggcagacggcggtgcggcacatcaccgagcagcgc
ttcatccacgggcaccggggcggtggcggcgggggctcccgcaaagcctcgaaccctgcg
ggcagcggacccaaccaccatgcgccgcagctgtctggcgactcggcgttgcccctctat
tccctgggcccgggagagcgagcgcacaacaccggcggcaccaaagtcttcccggaacgc
agcgggagcggcagtgccagtggcagcgggggcgggggcgacctgggtttcctgcacctc
gactgtgccccgagtaactcggatttcttcctcaatgggggctacagctaccgaggggtc
attttccctaccctacgcaactccttcaagtctcgggatctggagcgcctctaccaacgc
tatttcctgggccagaggcgcaaatccgaggtagttatgaacgtgctggatgtgctaacc
aaactcaccctcttggtcctccacttgagcctggcctcggcccccatggacccactcaag
ggcatcctgctgggcttcttcaccggcatcgaggtggtggtctgcgccctcgtggtggtc
aggaaggaaaccacctcgcacacctacctgcaatacagcggagtggtcacttgggtagct
atgaccacccagattctggcagcgggcctgggctatgggcttctgggagacggcataggc
tatgtgctctttacactctttgcaacctacagcatgcttccgctgccgctcacctgggcc
atcctcgcgggcctgagcacgtcgctgttgcaagtcacccttcaagtgctcatacccagg
ctagcggtcttttccatcaaccaggtcctggcccaggtggtactattcatgtgcatgaac
acggctgggatcttcatcagttacctgtcagaccgcgcccagcgccaggccttcctggag
acacggaggtgtgtggaggccaggctacgcctagagacagagaaccaaagacaggagcgg
ctagtgctgtctgtgcttcccaggttcgtcgtcctggagatgataaacgacatgaccaac
gtggaggacgaacatctgcaacatcagtttcaccgtatctacattcaccgttacgagaat
gtcagtattctttttgcagatgtcaaaggatttaccaacctctctacgaccttgtctgct
caggagctggtcaggatgctcaacgagctctttgccagatttgaccggctggcccatgag
catcattgtcttcgcattaaaatcctgggggactgctactactgcgtgtctggactgccg
gagccccgccaggaccacgcccattgctgcgttgaaatgggcctcggcatgatcaaaacc
atcaggtatgtgagatccagaacaaagcatgacgttgacatgagaattggaatccattcg
ggctccgtgctatgcggtgtgttgggcctgaggaaatggcagtttgatgtctggtcttgg
gatgtggacattgcaaacaaactcgaatctggaggaatccctgggagaattcacatttcc
aaagccacactggattgcctcaatggggactacagcgtggaagagggccacgggaaagag
aggaacgagttcttgaggaagcataacatagagacttatttgattaagcagcctgaggag
actttgctgtccttgcctgaagacatagtcaaggagtcggtgagctcctcggacaggaga
aacagcggggcgacattcaccgaaggatcctggagcccagaactgcccttcgacaacatc
gtgggcaaacaaaacactctggctgccctaacaagaaattcaataaatctgcttccaaac
catctcgcacaagctttgcatgtccagtctgggcctgaggaaattaacaagagaatagag
cacaccatcgacttgcggagtggcgataaactaagaagagtgcatatcaagccattctca
ctgacgtttaaagactccagcctggagcacaagtgtgtctcctgcaggctggtgccaatg
accatccagttctccattctcatcatgatgcactctgcgctggtcctcgtcaccacggca
gaggactataagtgtctgccccttgtcctccgcaaaacctgctgttggattaatgaaacc
tacctggcccggaacgtcatcatctttgcctccatcttgattaatttcctgggagccgtc
ctcaacatctacttcgtcttcacgggggtgttggccatggtgacctgtgcggttttcctg
cggcttaactctgtcctgaagctggctgtgctgctgattatgattgctgtctacgccctg
ctgacagagactgtctacgcaggtctcttcctgagctatgacaacctcaaccacagtgga
gaagatttcctggggaccaaggaggcctcactgttgctgatggccatgttcctccttgcc
gtgttctaccatggacagcagctggaatacacggcccgcctggacttcctgtggcgagta
caggccaaagaggagatcaacgagatgaaggagctgagggaacacaatgagaacatgcta
cgcaacatcctacccagccacgtggcccgccacttcctggagaaagacagagataatgag
gagctgtactcgcagtcctacgacgctgttggggtgatgtttgcctccattcccggattt
gcagacttttactctcagacagaaatgaacaaccagggtgtggaatgtctacgcctcctg
aatgagatcattgccgactttgatgagctgcttggggaggaccggtttcaagacatagag
aagattaagaccattggtagcacgtacatggccgtctcaggactgtcaccagagaaacag
caatgtgaagataaatgggggcatttgtgtgccctggctgacttctctctcgccctgacc
gaaagcatacaggagatcaacaagcactcattcaacaattttgagctccgaattggcatc
agccacggctcagtggtagcaggcgtgattggtgccaagaaaccacagtatgacatctgg
ggtaaaacggtgaacttggccagtcgcatggacagcacaggggtgagcggccggatccaa
gttccagaggagacctaccttatcctgaaggaccagggttttgccttcgactatcgcgga
gagatctacgtgaagggcatcagcgagcaagaggggaaaatcaaaacgtactttctcctg
ggaagagtccaacccaacccattcatcttgccgccaaggagactgcccgggcaatactct
ctggctgcggttgtccttggccttgtccagtctctgaaccggcaaaggcagaagcaactg
ctcaatgagaacagcaactcaggcatcatcaagggccattacaaccggcggactttgtta
acacccagtgggccagagcccggagcacaagctgaaggcaccgacaaatccgatttgcca
tag

DBGET integrated database retrieval system