KEGG   Cricetulus griseus (Chinese hamster): 100751390Help
Entry
100751390         CDS       T02813                                 

Definition
(RefSeq) insulin receptor substrate 1
  KO
K17445  insulin receptor substrate 3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04022  cGMP-PKG signaling pathway
cge04068  FoxO signaling pathway
cge04140  Autophagy - animal
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04910  Insulin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04930  Type II diabetes mellitus
cge04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100751390
   04022 cGMP-PKG signaling pathway
    100751390
   04152 AMPK signaling pathway
    100751390
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100751390
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100751390
   04923 Regulation of lipolysis in adipocytes
    100751390
   04920 Adipocytokine signaling pathway
    100751390
   04935 Growth hormone synthesis, secretion and action
    100751390
  09149 Aging
   04211 Longevity regulating pathway
    100751390
   04213 Longevity regulating pathway - multiple species
    100751390
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100751390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH
Motif
Other DBs
NCBI-GeneID: 100751390
NCBI-ProteinID: XP_027272048
UniProt: G3I658
Position
4
AA seq 493 aa AA seqDB search
MKPAGAGPAVSPGTESTDVSLGPPFPWPCPPDVRLCGHLRKQKSQRRRFFVLRADPPRLE
CYENEKKFLASGCRPPRPRRSVSLEGACTISKRADARQRHLIVVYTSDSSLGVAAASEAE
QQAWYSALLEVRASAAAAAATAMGLSPQEAPESWIFAPFQDVWPVTLRSKGLGRVQGLSS
GSYRLCLGSGALSLLRKPGSKGSKDSRASPPPALRLSLLSVRRCGHADSFFFLELGRSAP
TGPGELWMQAPDAVVAQSIHETVLAAMKRLGSSATSGKAELPSGDLPNSASAAPAPTTYE
TPASVTQPKSPGERAKQDCKTLERTGPTPSYKGLDLGGDYITMGVRDDYVHMGGKAGDYM
WMAPPSLPPAPARVDSGKSLQDCEGTEYVPMNRFLPGSFYYELKAREPELGHQGAPCSIR
DRWGPTEAQPRSSQLSELSGDYMYIPDSVGMNSAKPGALDSCLNYVDLDLVPPLEVPGAV
SEDSPNSYASIKF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggcaggtgcgggtcccgcggtctcccccgggaccgagtccacggatgtgtcg
cttggcccgccgtttccttggccctgcccacccgatgtgcggctgtgtggccacctgcgg
aagcagaagtctcagcgccgccgcttcttcgtcctgcgtgctgaccctccgcgtctggag
tgctacgagaacgagaagaagttcctcgccagcggctgccgcccacctcgaccccggcgc
agtgtgagcctggagggcgcctgcactatcagcaagcgcgcggatgcccgccagcgccac
ctcatcgtcgtctacaccagcgacagcagcctgggcgtagcggcggccagcgaagctgag
cagcaagcatggtacagcgccctcctggaggtgcgcgcctcggccgcggcagctgctgcc
accgctatgggtctcagtccccaagaggcccctgagtcttggatcttcgccccgttccag
gacgtctggcctgtgacactgaggtccaaggggctggggcgtgtacaaggcctgagcagc
ggcagctatcgcctgtgcctgggttctggggccctgagcctcctgcggaagccaggaagc
aaaggctccaaagacagccgggcatcgccaccacccgccctgcgtctgtccttgctcagc
gtgcgccgctgtggccacgcagactccttcttcttcctggaactcgggcgatcagcgccc
acaggtcccggggagctgtggatgcaggcacctgatgcagtggtggcccaaagcattcat
gagaccgtcctggctgccatgaagaggctggggagcagtgcaaccagtggcaaggctgag
ctaccatctggagatcttccaaacagtgcttctgcagcccctgccccgacaacatacgaa
acccctgcttctgtaacgcaaccaaaaagcccgggtgagagagcaaagcaagactgcaag
accttggaaaggacggggcccacaccctcctacaagggtctagatctgggcggggactat
atcaccatgggcgtcagggatgactatgtgcacatgggagggaaggctggtgactacatg
tggatggcacccccaagccttcctcccgcccctgccagggtagattctggcaagtcactt
caggactgtgagggcacagagtacgtgcccatgaatagatttttaccagggtctttttac
tacgagctcaaggccagggagcctgaacttgggcatcagggtgccccctgcagcattagg
gacagatggggacccacagaggctcagccccgctcttcccaactttcagaactatctggg
gattacatgtacatcccagactctgtaggaatgaacagtgctaagccaggggccctggat
agctgcctcaactatgtggacctggacctagtcccgcccttggaggtgcctggagcagtc
tctgaggatagtccaaatagttatgccagcatcaagttctag

KEGG   Cricetulus griseus (Chinese hamster): 100755710Help
Entry
100755710         CDS       T02813                                 

Gene name
Irs1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04022  cGMP-PKG signaling pathway
cge04068  FoxO signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04722  Neurotrophin signaling pathway
cge04910  Insulin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100755710 (Irs1)
   04022 cGMP-PKG signaling pathway
    100755710 (Irs1)
   04151 PI3K-Akt signaling pathway
    100755710 (Irs1)
   04152 AMPK signaling pathway
    100755710 (Irs1)
   04150 mTOR signaling pathway
    100755710 (Irs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100755710 (Irs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100755710 (Irs1)
   04923 Regulation of lipolysis in adipocytes
    100755710 (Irs1)
   04920 Adipocytokine signaling pathway
    100755710 (Irs1)
   04935 Growth hormone synthesis, secretion and action
    100755710 (Irs1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100755710 (Irs1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100755710 (Irs1)
  09149 Aging
   04211 Longevity regulating pathway
    100755710 (Irs1)
   04213 Longevity regulating pathway - multiple species
    100755710 (Irs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100755710 (Irs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100755710 (Irs1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100755710 (Irs1)
   04931 Insulin resistance
    100755710 (Irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 100755710
NCBI-ProteinID: XP_027253161
UniProt: G3IDC4
Position
2
AA seq 1233 aa AA seqDB search
MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAH
HDGAGGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYR
LCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSV
VAQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSR
TESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSR
LHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGG
FISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLTAPNGHYI
LSRGGNGHRYIPGANLGTSPALTGDEATSAADLDNRFRKRTHSAGTSPTISHQKTPSQSS
VASIEEYTEMMPAAYPPGGGSGGRLPSYRHSAFVPTHSYPEEGLEMHPLERRGGHHRPDT
STLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYM
MMSPSGSCSPDIGGGSSSSSGAAASGSSYGKPWTNGVGGHHSHALPHSKPPTESGSGKLL
PCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGARH
QHLRLSSSSGRLLYAATAEDSSSSTSSDSLGGAYCGARPESGLPHPHHHVVQPHGPRKVD
TAAQTNRRLPRPTRLSLGDPKASTLPRVREQQQPSLHPPEPKSPGEYVNIEFGSGQPGYL
AGPATSHSSPSVRCPPQLHPAPREETGSEEYMNMDLGPGRRATWQESGGVELGRVGPAPP
GAATICRPTRSVPGSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTSIGAEKVSLPRTT
GAAPSSSSTASASPAAPEGAAEQAAHSSLLGGPQGPGGMSAFTRVNLSPNHNQSAKVIRA
DTQGCRRRHSSETFSAPTRAGNTVSFGAGAAVGGSGGGAGGGSSSSEDVKRHSSASFENV
WLRPGDLGGASKETAQVCGAAGGLESNLNYIDLDLAKDVRQRPQECPSQQQPLPPPAPHQ
PSRNNEGSSPRRSSEDLSTYASINFQKQPEDHQ
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggataccgatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagtatgcacaagcgctttttcgtactgcgggcagccagcgaggccgggggc
ccggcgcgcctggaatactatgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccttggagagctgtttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgagacgaacactttgccattgcggcagatagcgag
gctgagcaagacagctggtaccaggctcttctgcagctgcataaccgagcaaaggcccac
catgacggcgctggaggtggaggctgcggcggtagttgcagcggcagctctggcgtcgga
gaagcaggggaggacttgagctatgacacgggcccaggacctgcgttcaaggaggtctgg
caggttatcctgaaacccaaaggtctgggtcagacaaagaacttaattggcatctaccgc
ctctgcctgaccagcaagaccatcagctttgtgaagctcaactccgaggcagcggctgtg
gtgctacagctaatgaacatcagacgctgtggccactcagagaacttcttcttcatcgag
gtggggcgttctgccgtgacaggacccggcgagttctggatgcaagtggatgactccgtg
gtagcccagaacatgcatgagaccattctagaggccatgcgggccatgagcgatgagttt
cgcccacgcagcaaaagccagtcttcatccagttgctccaaccccatcagtgttcccctt
cgcaggcaccacctcaacaaccctccacccagccaggtggggctgactcgccgatctcgc
actgagagcatcaccgccacctcccctgccagcatggtgggagggaaaccaggttccttc
cgagtgcgagcctccagcgatggcgaaggcaccatgtcccgtccagcatcagtggatggt
agtcctgtgagcccgagcaccaacaggacccacgcccatcggcaccgagggagctccagg
cttcaccccccactcaaccacagccgctccatccctatgccttcttcccgctgctcacct
tcagccaccagcccagtaagtctgtcatccagtagcactagtggccatggctccacctca
gactgtctcttcccgagacgatctagtgcttccgtgtcaggttctcctagtgatggcggt
ttcatctcttctgatgagtatggttctagtccctgcgatttccgcagttccttccgcagt
gtcaccccagattccctgggtcacaccccaccagccaggggtgaggaagaactgagcaac
tatatctgcatgggtggcaagggagcctccaccctgactgctcccaatggtcactacatt
ttgtctaggggtggcaatggccatcgctacatcccaggtgctaacttggggacaagccca
gcgttgactggggatgaagccaccagtgcagcagatctggacaaccggtttcggaagaga
actcactccgcaggcacgtcccctaccatttcccatcagaagaccccctcgcagtcttca
gtggcttctattgaggagtatacagagatgatgcctgctgcctacccaccaggaggtggc
agtggaggccgactgcccagctatcggcattccgccttcgtgcccacccactcctacccc
gaagagggtctcgagatgcaccccttggagcgtcgtgggggccaccaccgtccagacacc
tccaccctgcacactgatgatggctacatgcccatgtctccaggggtggcgccagtgcca
agcaaccgtaaagggaatggggactatatgcccatgagccccaagagtgtctctgcccca
caacagatcattaaccccatcagacgtcaccctcagagagtggaccccaatggctacatg
atgatgtctcccagtggcagttgctcccctgacattggaggtgggtccagcagcagcagc
ggtgcagccgcttcggggagtagctacgggaagccatggacaaatggagtaggggggcac
catagtcatgccctgcctcattccaaaccccctactgagagtggcagtggcaagctcttg
ccctgcacaggcgactacatgaacatgtcaccagtgggagactccaacaccagcagcccc
tcagaatgctactatggcccagaagatccccagcacaagccagtcctctcctactactca
ttgccaaggtctttcaagcacacccagcgccctggggagccagaggagggtgccaggcac
cagcatcttcgtctctcttctagctctggacgccttctctatgctgcaactgcagaagat
tcttcctcttctaccagcagtgacagcctgggtggggcttactgtggggctaggccagag
tccggcctcccacatccccaccaccatgtcgtgcaaccccatgggccccgaaaggtagac
acggctgcacagaccaaccgccgcctgccccggcccacaaggctctccttgggagatccc
aaggcaagtaccttaccccgggtacgggagcagcagcagccttcgttgcaccctcccgag
cccaagagcccaggggaatatgtgaatattgaattcgggagtggccagcctggctattta
gcgggcccggcgacttcccacagctctccttcggttcggtgtccaccccagctccaccca
gctccccgagaagagactggctcagaagagtacatgaacatggacttggggccaggccgg
agggcaacgtggcaggagagtggtggggttgagttgggtagagtaggccctgcacctcca
ggggctgctaccatttgcaggccaacccggtcagtgccaggtagccgtggtgactacatg
accatgcagataggttgtcctcgtcaaagctatgtggatacctcaccagtggccccagtc
agctatgctgacatgcggacaagcattggcgccgagaaggtgagcctgcccagaaccaca
ggggctgctccatcttcatcctccacagcctctgcttctcctgctgcacctgaaggcgca
gctgagcaggctgctcactcttctctgctgggaggccctcagggacctgggggcatgagt
gcattcaccagagtgaacctcagtcccaaccataaccagagtgccaaagtgattcgtgca
gacactcaaggctgccggaggaggcacagctccgagaccttctcagcacctactcgggct
ggcaacacggtgtcctttggagcaggggctgcagtagggggcagtggcggtggagctggc
ggtggcagcagcagcagtgaggatgtaaaacgccacagctctgcatcatttgagaatgtg
tggctgagacctggggatctagggggagcctccaaggagacggctcaagtgtgtggggct
gctgggggtttggagagtaatcttaactacatagacctggatttagccaaggatgttaga
cagcgtcctcaggaatgcccttctcaacagcagccccttccaccccctgcccctcaccag
ccctcacgcaacaacgagggcagctcccccagacgctccagtgaggatttaagcacctat
gccagcatcaacttccagaagcagccagaggaccatcaatag

KEGG   Cricetulus griseus (Chinese hamster): 100771848Help
Entry
100771848         CDS       T02813                                 

Gene name
Irs2
Definition
(RefSeq) insulin receptor substrate 2 isoform X2
  KO
K07187  insulin receptor substrate 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04022  cGMP-PKG signaling pathway
cge04068  FoxO signaling pathway
cge04140  Autophagy - animal
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04910  Insulin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04935  Growth hormone synthesis, secretion and action
cge05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100771848 (Irs2)
   04022 cGMP-PKG signaling pathway
    100771848 (Irs2)
   04152 AMPK signaling pathway
    100771848 (Irs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100771848 (Irs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100771848 (Irs2)
   04923 Regulation of lipolysis in adipocytes
    100771848 (Irs2)
   04920 Adipocytokine signaling pathway
    100771848 (Irs2)
   04935 Growth hormone synthesis, secretion and action
    100771848 (Irs2)
  09149 Aging
   04211 Longevity regulating pathway
    100771848 (Irs2)
   04213 Longevity regulating pathway - multiple species
    100771848 (Irs2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100771848 (Irs2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100771848 (Irs2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100771848 (Irs2)
   04931 Insulin resistance
    100771848 (Irs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 100771848
NCBI-ProteinID: XP_027243682
Position
1
AA seq 1332 aa AA seqDB search
MASAPLPGPPAPAGGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGTGGDEA
AAAGGSPPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
YFAVAAENEQEQEGWYRALTDLVSEGRSGDGASGIGATGGSCSASLPGVLGGSAGAAGSD
DNYGLVTPATAVYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQ
LMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFR
PRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCTSCRV
RTASEGDGGTGAGAGAAGGRPMSVAGSPLSPGPVRVPLSRSHTLSGGCGGRPSKVTLAPA
GGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPLPPGPHPHLPHPLHHPQGQRP
SSGSASASGSPSDPGFMSLDEYGSSPGDLRAFSSHRSNTPESIAETPPARDGSGGELYGY
MSMDRPLSHCGRPYRRVSGDGAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMR
ATFSGSSGRLCPSFPASSPKVAYHPYPEDYGDIEIGSHKSSSSNLGADDGYMPMTPGAAL
RSGGPNSCKSDDYMPMSPTSVSAPKQIMQPRSVASAALPPSGAAVPAPPSGAGRTFPVNG
GSYKASSPAESSPEDSGYMRMWCGSKLSMENADPKLLPNGDYLNMSPSEAGTAGTPPDFF
SAALRGSSEGLKGVPGHCYSSLPRSYKAPYCSGDSDQYVLMSSPVGRILEEERLEPQATP
GTSQLAGTFGASGGGHTQPHHSAVPSPMRPSGSGGRPEGFLGQRCRAVRPTRLSLEGLQT
LPSMQEYPLPAEPKSPGEYINIDFGEAGTRLSPPAPPLLASAASSSSLLSASSPASSLGS
GTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGTHSGDTVGSMDGLLSPEASSPYPPLPPR
PSASPSSLQQPLPPAPGELYRLPPASAATSQGPTAGSSKSSEPGDNGDYTEMAFGVAATP
PQPIAAPPKPEGARVTSPTSGLKRLSLMEQVSGVEAFLQVSQPPDPHRGAKVIRADPQGG
RRRHSSETFSSTTTVTPVSPSFAHNSKRHNSASVENVSLRKSSEGSGILGGSDEPPTSPG
QAQPSVAVPPAPQARPWNPGQPGALIGCPGGSSSPMRRETSVGFQNGLNYIAIDVRDEQG
SLSQTQPQHPQPGDKSSWGRTRSLGGLLGTVGSTGSSGVCGGPGTGALPSASTYASIDFL
SHHLKEATVVKE
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgcgccccttcctgggccccccgcgccggcgggtggggacggcccgaacctc
aataacaacaacaacaacaacaaccacagcgtgcgcaagtgcggctacctgcgcaagcag
aagcacggccacaagcgcttcttcgtgctgcgcggccccggcacaggcggagacgaggca
gccgcagccggggggtcgccgccgcagccgccgcggttggagtactacgagagcgagaag
aagtggaggagcaaggcaggcgcgccgaagcgagtgatcgcgctcgactgctgcctgaac
atcaacaagcgcgcggacgccaagcacaagtacctgatcgccctctacaccaaggacgag
tactttgccgtggcggcggagaacgagcaggagcaggaaggctggtaccgcgcgctcacc
gacttggtcagcgagggtcgctctggtgatggggcctcgggcatcggggccaccggcggg
tcctgcagcgcctctcttcctggcgtactgggtggctcggcaggcgccgctggctccgat
gacaactacgggctcgtgacgcccgccacggcagtctaccgcgaggtgtggcaggtgaac
ctgaagcccaagggcctgggccagagcaaaaacctgaccggtgtataccgcctatgcctg
tctgcgcgcaccatcggcttcgtgaaactcaattgcgaacagccgtcggtgactctgcag
ctcatgaacatccgccgctgcggccactcggacagcttcttcttcatcgaggtgggccgc
tcggcggtcaccggccccggcgagctgtggatgcaagccgacgactcggtggtggcgcag
aacatccacgagaccattctggaggccatgaaggcgcttaaggagctctttgagttccgg
cctcgaagcaagagtcagtcgtccgggtcgtcggccacgcaccccatcagcgtgccgggc
gcgcgccgccaccatcacctggtcaacctgcccccaagccagaccggccttgtgcgccgc
tcgcgcaccgacagcttggcggccaccccgccagcagccaagtgcacctcgtgtcgggtc
cgtacagccagcgagggcgacggcggcacgggagcaggggctggggcagcgggaggcagg
cctatgtcggtagccgggagccccctgagtcccgggccggtgcgcgtgcccctgagccgc
tcgcacaccctgagcggcggctgcggaggccgcccgagcaaagtgacgctggcgccggca
gggggcgccctgcaacacagccgctccatgtccatgcccgtggcgcactcgccgcctgca
gccaccagccctggcagcctgtcctccagcagtgggcacggctcaggctcctacccgctg
ccccccggcccccacccgcacctgcctcatccactgcaccacccccaaggccagcgtccg
tccagcggcagtgcctcagcctccggctcccccagtgacccgggtttcatgtcacttgat
gagtatggctccagccctggcgacctcagagccttcagtagccacaggagcaacacgccc
gagtcaatcgcagagaccccgccagccagggacggcagtgggggcgagctctatgggtat
atgagcatggatagacccctgagccactgtggccgcccttaccgcagggtctctggggat
ggggctcaggacctggacagaggactgaggaagaggacttattccctgaccacgcctgcc
aggcagcggccagtaccccagccttcctctgcctccctggatgaatatactctcatgcgt
gccaccttctctggcagttcaggacgcctctgcccatcgttccctgcgtcctctcctaaa
gtggcctaccacccttacccagaggactatggagacattgagattggctctcacaagagt
tctagcagtaacttaggggcagatgatggctacatgcccatgacccctggggcggccctc
aggagtggtggccccaacagctgcaagagtgatgattatatgcccatgagccccaccagt
gtgtctgcccccaagcagatcatgcagccgaggtcagtggcctcagcagccttgccccct
tcaggagcagcagtgccagcacccccttcaggggcaggcaggaccttcccagtgaatgga
ggcagctacaaagccagctcccccgcggagagctccccagaggatagcgggtacatgcga
atgtggtgtggctccaagttgtccatggagaatgcagacccaaagctgctccccaatggg
gactacctcaacatgtcccccagcgaggctggcactgcgggcacgccacctgactttttc
tcagcagctttgcgtggaagcagtgagggcctcaaaggtgtccctggccactgctacagc
tctttgccccgctcttacaaggctccctattgcagtggggacagcgaccagtatgtgctc
atgagctcccctgtagggcgaatcttggaagaggagaggctggaaccccaggccacccca
gggacctcccagttggctggcacctttggggcgtctgggggtggccatacccagcctcat
cattcagcagtgccttcccccatgaggcctagtggcagtggtggccgccctgagggcttc
ctgggccagcgctgtagggcagtacgacctacacgcttgtccctggagggactgcagacc
cttcccagcatgcaagagtaccctctacctgcagagcccaagagccctggcgagtatatc
aacattgactttggtgaggcaggtacccggctgtccccgcctgcccccccactgctggca
tcggcagcttcatcctcttcgctgctttcagccagtagtcctgcatcatccctgggttca
ggtaccccaggcaccagcagtgacagccggcagcgctccccgctctctgactatatgaac
ttggacttcagttctcccaagtcccctaagcctggcacccatagtggggacacagtgggc
tccatggatggccttctctccccagaggcctcatccccatacccaccgctacccccacgt
ccttctgcctccccttcttctctgcagcagcctctgccacctgccccaggagagctatac
cgcctgcctccagcatcagctgccacttcccagggacctactgctggctcctcaaagtcc
tcggagcctggggataatggcgactataccgagatggcctttggtgtggctgctaccccg
ccacaacctattgcggcacccccaaagccagaaggtgcccgagtgaccagtcccacatcg
ggcttgaagcggctaagtctcatggagcaggtgtctggggtggaggcctttcttcaagtc
agccagccccctgatccccaccggggtgccaaggtcatccgtgcagacccacaggggggg
cgacgtcgccacagttcagagaccttctcttctactaccacagtcaccccagtgtccccc
tccttcgcccacaactccaagcgccacaattcggcctctgtggaaaacgtctctctcagg
aaaagcagtgaaggcagtggcatcctgggaggaagtgatgagccacccacatccccggga
caggcacagccctcggtggctgtgccaccagcgccacaggctagaccatggaacccgggt
cagcctggagctttgattggctgtccgggagggagcagttctcccatgcgcagagagacc
tccgtgggtttccagaacggcctcaactacattgccattgatgtgagggatgagcagggg
tccttatcgcagactcagcctcagcatccacagccaggagacaagagctcttggggccgg
acccgtagccttgggggtctcctcggcaccgtgggaagcactggcagcagcggggtgtgt
gggggcccaggcactggagccttgccctctgccagcacctatgccagcatcgacttcttg
tcccatcacttgaaggaagccacagtcgtgaaagagtga

KEGG   Cricetulus griseus (Chinese hamster): 100773159Help
Entry
100773159         CDS       T02813                                 

Definition
(RefSeq) insulin receptor substrate 4 isoform X2
  KO
K17446  insulin receptor substrate 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04022  cGMP-PKG signaling pathway
cge04068  FoxO signaling pathway
cge04140  Autophagy - animal
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04910  Insulin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04930  Type II diabetes mellitus
cge04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100773159
   04022 cGMP-PKG signaling pathway
    100773159
   04152 AMPK signaling pathway
    100773159
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100773159
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100773159
   04923 Regulation of lipolysis in adipocytes
    100773159
   04920 Adipocytokine signaling pathway
    100773159
   04935 Growth hormone synthesis, secretion and action
    100773159
  09149 Aging
   04211 Longevity regulating pathway
    100773159
   04213 Longevity regulating pathway - multiple species
    100773159
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100773159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH_11 PH_8
Motif
Other DBs
NCBI-GeneID: 100773159
NCBI-ProteinID: XP_027289355
Position
X
AA seq 1245 aa AA seqDB search
MASCSFAGDRALRRLRAAAAAASTALAAVATTRRRSSGTPTALIGTRSSCPGAMWLPTAT
GSRSDSESEEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENAKKFRL
SVRAAAAAAAAAASGAAVPALIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGLLGAQPDGEPAALAAAAAAEPPFYKDVWQVVVK
PRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSIGVGAHLLTLLSTRRH
LGLLPLEPGGWLRRSRFEQFCHLRAIGDREEMFFTRRLILNEPLPPSRRERGHLPRARRS
RRAVSGPPSFSRRLAPSPPVRVSHPEEASYDRACEASGSNSGNSEEKDKEGEEENEGDYM
PMYYWGSGNGRGSGGGQGSSGQGSSSQSSGGNQCSGGSQGSGGGQGSGGRGSGGQGAGGN
QCSGNGQGTAGGHGSGGGQRPGGGHGSGGGRRPGDGHGSGGGKNSGGGKGSGSGKNSDDG
DRGKSLKKRSYFGKFTQSKQQQMLPPPPPPPPPAGGATGGKSKSGGRFRLYFCADRGATK
ERKEAKERRDRETPEGATRGPHRARAFDEDEDDPYVPMRPGVASPLACSSDYMPMAPQNS
SASKSRHSRSPFEDSRGYMMMFPRVSPPPPVPSPPKAPDTNKEDDSKDNDSDSDYMFMAP
GAGAIPKNPPNPQGGSSSKSWSSYFSLPSPFQSSPLGQSDHSEYVPMLPGKFLGRGVDKE
ASFSQGTKDVSSKPSTEGSFSKPGDRESPAKPSDDEPPVNKAKRPNRLSFIAKGNKIKPK
PEEPTQEQRGADSSGDYINTDFIKRERPVPTPSAQGLPDSWGLVTDPRRTAFSSYMNIEL
EVPFPNPAIRLSDLLRVLPGANSISLAGARWPFHPFPGSATGRIVEEGGYIQVIFNPAMR
PLVPFADSAIRYDVQTGEIYVVDPFSECCMDISLYPSRCFQPPPVARLLQEEVQERRRPQ
SRSQSLFANTRAAVSAFPTDSLDRDFPAASAGVVLPDGEPLLAVSRALAIVSALAAAPGF
GAIFAGFQSTPGYDSASARCFQPVANALGAQAVRGVQDIAAGWNPGALNQAAGGEDLAAG
AAAPPLPPRQRRVLRPPERADSEDDEDDGDDIYVRMDFARRDYKK
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttgctccttcgctggcgaccgagcactaaggagactgagagctgcagcagca
gcagcctccacagctctagcagcagtggcgaccacccggcgtcgttcctcgggaaccccg
accgcactcattgggacccggtcgtcctgtccgggagctatgtggctccccacggccact
ggctcccggtcagactccgagtccgaagaggaggacctccccgtcggggatgaagtctgc
aaacgcggctacctgaggaaacagaagcatgggcacaggcgttacttcgtgctcaaactc
gagaccgcagacgccccggctcgtctggaatactacgaaaatgccaagaagttccgcctc
agtgtccgcgccgcggcggctgcggcagcagctgccgcctcgggtgctgcggtccccgcg
ctcatcccaccgagacgcgtgatcaccctgtaccagtgcttctccgtgagccaacgagct
gatgccaggtaccgacaccttattgcccttttcacccaggacgagtacttcgcgatggtg
gccgagaacgagtcggaacaagaaagctggtacttgctcctcagccgcctcatcctcgag
agcaagcgccgccgctgcggcttgctaggcgcgcagccggacggagagccggcggccctg
gcggcagcagcggcggcggagccacccttctacaaagatgtgtggcaggtagtagtgaaa
cccagggggctggggcacagaaaagagctgagcggcgtgttccggctgtgtcttaccgac
gaagaggttgtgtttgtgaggctcaataccgaagtggccagtgtggtcgtccagctgctg
agcattcgtcgctgtgggcactcagagcagtacttcttcctggaagtcggcaggtccact
gtcatcggtccaggggagctgtggatgcaggtagatgactgtgtggtggcccaaaatatg
catgagttgtttttggagaagatgagagccttgtgcgcagatgagtacagagcccgatgc
cgcagctacagcatcggcgttggcgcccacctgttaaccctgctgtccactaggaggcac
ctgggcttgctcccgctggagcccggcggctggctccgaagatcccgctttgagcagttt
tgccacctcagggctatcggagacagggaagagatgttctttaccagacgcctcatactc
aacgagcctctgcctccctccaggcgagaaagggggcacctgcccagagcccgcaggtcc
aggagagctgtttcaggaccacccagcttttcccgccgcctagcacctagcccgccggta
cgtgtctcacaccctgaagaagcctcttacgacagagcttgtgaagcctcgggctccaac
tctggcaactctgaagaaaaagacaaggaaggtgaggaagaaaacgaaggtgattacatg
cccatgtactactggggctcaggaaatggccggggctctggaggtggacagggctcaagt
ggccaaggctccagcagccagagctcaggaggaaaccagtgctcaggtggcagtcaggga
tctggaggtggccagggctcaggaggccggggttcaggaggtcagggtgctggaggaaac
cagtgttcaggaaatggccagggcacagcaggtggccatggatcaggtggaggccagagg
cctggtggtggccatggctcaggtggtggccggagacctggagatggtcatggctcaggt
ggcggcaagaactcaggaggaggcaagggctcaggaagtgggaaaaactcggatgacggt
gaccgtggaaaatctctgaagaaaagatcatactttggtaaattcactcaaagcaagcaa
cagcaaatgctgcctccacctcctcctccacccccgccagccggaggagcaactggtgga
aaaagcaagtctgggggaagattccgactttatttttgtgcagacagaggggccacaaaa
gaacgcaaagaagccaaagagaggagagatagggaaactccagaaggtgccacccggggg
cctcacagagccagagctttcgatgaagacgaggatgacccatacgtgccaatgaggcca
ggggtggcttcccctcttgcatgttccagtgactacatgccaatggcacctcaaaattcc
tctgcttcaaaaagccgccactctaggtcaccattcgaagattccagaggatatatgatg
atgtttcccagagtgagtccaccaccacctgtcccaagtccccccaaagcaccggatact
aataaagaggatgactctaaggacaatgacagtgacagtgactacatgtttatggctcct
ggagcaggtgcaattcctaaaaatccccccaatcctcagggaggctcttcctccaaaagt
tggagctcttacttttctctgccgagtccttttcagagttcacctttgggacagagcgac
cacagtgagtatgtcccaatgttgcctgggaagttcctggggaggggtgtagacaaagaa
gcctcctttagccagggcaccaaagatgtgtcttcaaagccttccactgagggctcattc
tcaaaacctggagatagggagtcacctgcaaagccttcagatgacgagcccccagtgaac
aaggctaagagacctaaccgactttcttttattgcaaaaggaaacaaaatcaagcccaaa
ccagaagagcccacacaggagcagagaggagctgacagctctggtgactatatcaacact
gacttcattaagagagagcgccctgtgccaactccctctgctcaaggactgccagattca
tggggcttagttactgaccccagacgcacagctttttccagttacatgaatattgaatta
gaggtgccctttccaaatccagcaatccgcctctcagatcttttaagagttctaccaggt
gccaactccatctctctggccggtgctaggtggccgtttcatcctttcccaggcagcgct
acaggacgtattgtggaagagggtgggtacattcaagtaattttcaacccagccatgaga
ccgctcgtgccttttgctgacagtgccattcgctatgatgttcaaaccggtgaaatctat
gtagttgacccattttctgagtgctgtatggacatttctctctaccccagtcgatgcttt
cagccgccacctgtagctaggctgctgcaggaggaagtgcaggagagaagacgcccacaa
agccgttcccaaagtttatttgccaacacccgagccgctgtctctgctttcccaactgac
agcttggacagagattttcctgccgcttctgctggggttgttcttccagatggggagccc
ctcttggcagtgagccgggctttagctatagtctctgcgctagcagcggcccccggcttt
ggcgctatctttgccggcttccagtccactcctggatatgactccgcctctgctcgctgt
ttccaacctgttgctaatgctcttggtgcccaggctgtaagaggggtccaggacattgca
gcaggctggaatcctggagcccttaaccaagctgccggaggagaggatctggcggccggc
gcagccgctcccccactgccacctcgccagcgaagagtgctgagacccccagagagagct
gattccgaggacgacgaggatgatggcgacgatatttacgtgagaatggactttgccaga
cgcgactacaagaagtga

DBGET integrated database retrieval system