KEGG   Cricetulus griseus (Chinese hamster): 100751891Help
Entry
100751891         CDS       T02813                                 

Gene name
Irak4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04064  NF-kappa B signaling pathway
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04722  Neurotrophin signaling pathway
cge05133  Pertussis
cge05135  Yersinia infection
cge05140  Leishmaniasis
cge05142  Chagas disease (American trypanosomiasis)
cge05145  Toxoplasmosis
cge05152  Tuberculosis
cge05161  Hepatitis B
cge05162  Measles
cge05164  Influenza A
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100751891 (Irak4)
   04064 NF-kappa B signaling pathway
    100751891 (Irak4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100751891 (Irak4)
   04621 NOD-like receptor signaling pathway
    100751891 (Irak4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100751891 (Irak4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100751891 (Irak4)
   05133 Pertussis
    100751891 (Irak4)
   05152 Tuberculosis
    100751891 (Irak4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100751891 (Irak4)
   05162 Measles
    100751891 (Irak4)
   05164 Influenza A
    100751891 (Irak4)
   05161 Hepatitis B
    100751891 (Irak4)
   05168 Herpes simplex virus 1 infection
    100751891 (Irak4)
   05169 Epstein-Barr virus infection
    100751891 (Irak4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100751891 (Irak4)
   05140 Leishmaniasis
    100751891 (Irak4)
   05142 Chagas disease (American trypanosomiasis)
    100751891 (Irak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100751891 (Irak4)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100751891 (Irak4)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100751891 (Irak4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Death Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100751891
NCBI-ProteinID: XP_027252173
UniProt: G3IB29
Position
2
AA seq 462 aa AA seqDB search
MNKPLTPSTYVRSLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLIQIELFAPATLLLPADAVPKTVSSIPSREAAT
VAQTPGPCHEKVRTLVTPMPRVEQSYRPPDSSSPNNENLEISDTDTRFHSFSFYELKSIT
NNFDERPVSVGGNRMGEGGFGVVYKGCVNNTTVAVKKLGAMVEISTEELKQQFDQEIKVM
AKCQHENLVELLGFSSDSDDLCLVYAYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAAN
GISFLHENHHIHRDIKSANILLDKDFTAKISDFGLARASAKFTQTVMTSRIVGTTAYMAP
EALRGEITPKSDIYSFGVVLLELITGLAAVDENREPQLLLDIKDEIEDEEKTIEDYTDEK
MNDTDPASVEAMYAAASQCLHEKKNKRPDITKVQQLLQEISA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcctctgacaccatccacatacgtacggagcctcaatgttggactcattagg
aagctgtctgattttattgatcctcaagaaggatggaagaaattagcagtagctattaaa
aagccgtctggtgatgataggtacaatcaatttcatataaggagatttgaagccttactc
caaactgggaaaagccccacgtgtgagctgctgttcgactggggcaccacaaactgcaca
gttggtgaccttgtggatcttctgatccagattgagcttttcgcccctgctactctcctg
ctgccagcagatgctgttcccaaaactgtcagcagtataccttctagagaagctgcaacg
gtggcacagacacctgggccctgccatgaaaaagtcaggacattggtaacgcctatgcca
agggtagaacaaagctataggccacctgactcctcaagcccaaacaatgaaaacttagaa
atcagtgatactgatactcgttttcacagtttttctttttatgaactgaagagtatcact
aataactttgacgagcgacctgtttctgtgggtggcaacagaatgggagagggaggcttt
ggagtggtgtacaaaggctgtgtgaacaacacaactgtggcagtgaagaagcttggagcg
atggttgaaatcagtactgaggaactaaagcaacagtttgatcaagaaattaaagtcatg
gcaaagtgtcagcatgaaaacctggtagagctacttggcttctcaagcgacagtgatgac
ctgtgtttagtatatgcttacatgcccaatggttccttgttggacagactatcctgcttg
gatggcaccccaccactttcttggcacatgagatgcaagattgctcagggtgcagctaat
ggtatcagttttctgcatgaaaatcatcatattcatagagatattaaaagtgcaaatatc
ttactagacaaagactttactgccaaaatatctgactttggacttgcccgggcttcggca
aagtttacccagacagtaatgacgagccgaattgtgggcacaacggcttatatggcacct
gaagctctgcgaggagaaataacacccaaatcggatatctatagctttggtgtggtttta
ttagaactaatcactgggcttgcagctgtggatgaaaaccgtgagcctcaattactactg
gatattaaagacgagattgaagatgaagagaagacgattgaagattacaccgatgagaag
atgaatgatactgaccctgcttctgttgaagcgatgtatgctgcagctagtcagtgtctg
catgaaaagaaaaataagaggccagacattacgaaggttcaacagctgctacaagagata
tctgcttaa

DBGET integrated database retrieval system