KEGG   Cricetulus griseus (Chinese hamster): 100752454Help
Entry
100752454         CDS       T02813                                 

Gene name
Akt3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04261  Adrenergic signaling in cardiomyocytes
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04728  Dopaminergic synapse
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04920  Adipocytokine signaling pathway
cge04922  Glucagon signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05145  Toxoplasmosis
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100752454 (Akt3)
   04015 Rap1 signaling pathway
    100752454 (Akt3)
   04010 MAPK signaling pathway
    100752454 (Akt3)
   04012 ErbB signaling pathway
    100752454 (Akt3)
   04370 VEGF signaling pathway
    100752454 (Akt3)
   04371 Apelin signaling pathway
    100752454 (Akt3)
   04630 Jak-STAT signaling pathway
    100752454 (Akt3)
   04668 TNF signaling pathway
    100752454 (Akt3)
   04066 HIF-1 signaling pathway
    100752454 (Akt3)
   04068 FoxO signaling pathway
    100752454 (Akt3)
   04072 Phospholipase D signaling pathway
    100752454 (Akt3)
   04071 Sphingolipid signaling pathway
    100752454 (Akt3)
   04024 cAMP signaling pathway
    100752454 (Akt3)
   04022 cGMP-PKG signaling pathway
    100752454 (Akt3)
   04151 PI3K-Akt signaling pathway
    100752454 (Akt3)
   04152 AMPK signaling pathway
    100752454 (Akt3)
   04150 mTOR signaling pathway
    100752454 (Akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100752454 (Akt3)
  09143 Cell growth and death
   04210 Apoptosis
    100752454 (Akt3)
   04218 Cellular senescence
    100752454 (Akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100752454 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100752454 (Akt3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100752454 (Akt3)
   04620 Toll-like receptor signaling pathway
    100752454 (Akt3)
   04625 C-type lectin receptor signaling pathway
    100752454 (Akt3)
   04660 T cell receptor signaling pathway
    100752454 (Akt3)
   04662 B cell receptor signaling pathway
    100752454 (Akt3)
   04664 Fc epsilon RI signaling pathway
    100752454 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    100752454 (Akt3)
   04062 Chemokine signaling pathway
    100752454 (Akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100752454 (Akt3)
   04922 Glucagon signaling pathway
    100752454 (Akt3)
   04923 Regulation of lipolysis in adipocytes
    100752454 (Akt3)
   04920 Adipocytokine signaling pathway
    100752454 (Akt3)
   04929 GnRH secretion
    100752454 (Akt3)
   04915 Estrogen signaling pathway
    100752454 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    100752454 (Akt3)
   04917 Prolactin signaling pathway
    100752454 (Akt3)
   04926 Relaxin signaling pathway
    100752454 (Akt3)
   04935 Growth hormone synthesis, secretion and action
    100752454 (Akt3)
   04919 Thyroid hormone signaling pathway
    100752454 (Akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100752454 (Akt3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100752454 (Akt3)
  09156 Nervous system
   04725 Cholinergic synapse
    100752454 (Akt3)
   04728 Dopaminergic synapse
    100752454 (Akt3)
   04722 Neurotrophin signaling pathway
    100752454 (Akt3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100752454 (Akt3)
  09149 Aging
   04211 Longevity regulating pathway
    100752454 (Akt3)
   04213 Longevity regulating pathway - multiple species
    100752454 (Akt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100752454 (Akt3)
   05205 Proteoglycans in cancer
    100752454 (Akt3)
   05230 Central carbon metabolism in cancer
    100752454 (Akt3)
   05231 Choline metabolism in cancer
    100752454 (Akt3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100752454 (Akt3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100752454 (Akt3)
   05212 Pancreatic cancer
    100752454 (Akt3)
   05225 Hepatocellular carcinoma
    100752454 (Akt3)
   05226 Gastric cancer
    100752454 (Akt3)
   05214 Glioma
    100752454 (Akt3)
   05221 Acute myeloid leukemia
    100752454 (Akt3)
   05220 Chronic myeloid leukemia
    100752454 (Akt3)
   05218 Melanoma
    100752454 (Akt3)
   05211 Renal cell carcinoma
    100752454 (Akt3)
   05215 Prostate cancer
    100752454 (Akt3)
   05213 Endometrial cancer
    100752454 (Akt3)
   05224 Breast cancer
    100752454 (Akt3)
   05222 Small cell lung cancer
    100752454 (Akt3)
   05223 Non-small cell lung cancer
    100752454 (Akt3)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100752454 (Akt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100752454 (Akt3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100752454 (Akt3)
   04931 Insulin resistance
    100752454 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100752454 (Akt3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100752454 (Akt3)
   05135 Yersinia infection
    100752454 (Akt3)
   05152 Tuberculosis
    100752454 (Akt3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100752454 (Akt3)
   05170 Human immunodeficiency virus 1 infection
    100752454 (Akt3)
   05162 Measles
    100752454 (Akt3)
   05164 Influenza A
    100752454 (Akt3)
   05161 Hepatitis B
    100752454 (Akt3)
   05160 Hepatitis C
    100752454 (Akt3)
   05168 Herpes simplex virus 1 infection
    100752454 (Akt3)
   05163 Human cytomegalovirus infection
    100752454 (Akt3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100752454 (Akt3)
   05169 Epstein-Barr virus infection
    100752454 (Akt3)
   05165 Human papillomavirus infection
    100752454 (Akt3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100752454 (Akt3)
   05142 Chagas disease (American trypanosomiasis)
    100752454 (Akt3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100752454 (Akt3)
   01524 Platinum drug resistance
    100752454 (Akt3)
   01522 Endocrine resistance
    100752454 (Akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100752454 (Akt3)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100752454 (Akt3)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100752454 (Akt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like FTA2 PH_11 APH
Motif
Other DBs
NCBI-GeneID: 100752454
NCBI-ProteinID: XP_027274689
UniProt: G3HY42
Position
5
AA seq 479 aa AA seqDB search
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNLGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMECMDNERRPHFPQFSYSASGRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaggaaggttgggttcagaagaggggagaatatataaaa
aattggaggccaagatatttccttttgaagacagatggttcattcataggctataaagaa
aaacctcaagatgtggacttaccttatcccctcaacaacttttccgtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaatacatttattatcagatgtcttcaatggacc
actgttatagagagaacatttcatgtagatactccagaggaaagagaagaatggacagaa
gctatccaggctgtagcagaccgactgcagaggcaagaagaggagaggatgaattgtagt
ccaacttcacaaattgataacctaggggaggaagagatggatgcgtctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaggttattttagttcgagaaaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactcttactgagagcagagtacta
aagaacaccagacatccattcttaacatccttgaaatattccttccagacaaaagatcgc
ctgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagaa
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattctggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccatataaaaattacagattttggactttgcaaagagggaatcacagatgca
gccaccatgaagacattctgtggcacaccagagtatctggccccagaggtattagaagat
aatgactatggccgagcagtagactggtggggcctgggtgttgtcatgtatgaaatgatg
tgtgggaggttgcctttctacaaccaggatcatgagaaactctttgaactaatactaatg
gaagacattaaatttccccgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatcccaataaacgccttggtggagggccagatgatgcaaaagaaatcatg
aggcatagtttcttttctggtgtaaactggcaagatgtatacgacaaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatattttgatgaagaatttaca
gctcaaactattacaataacaccacctgaaaaatatgacgaagacggcatggagtgcatg
gacaacgagcggcggccacacttccctcagttctcctactctgcgagtggacgggagtag

KEGG   Cricetulus griseus (Chinese hamster): 100768351Help
Entry
100768351         CDS       T02813                                 

Gene name
Akt2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04261  Adrenergic signaling in cardiomyocytes
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04728  Dopaminergic synapse
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04920  Adipocytokine signaling pathway
cge04922  Glucagon signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05145  Toxoplasmosis
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100768351 (Akt2)
   04015 Rap1 signaling pathway
    100768351 (Akt2)
   04010 MAPK signaling pathway
    100768351 (Akt2)
   04012 ErbB signaling pathway
    100768351 (Akt2)
   04370 VEGF signaling pathway
    100768351 (Akt2)
   04371 Apelin signaling pathway
    100768351 (Akt2)
   04630 Jak-STAT signaling pathway
    100768351 (Akt2)
   04668 TNF signaling pathway
    100768351 (Akt2)
   04066 HIF-1 signaling pathway
    100768351 (Akt2)
   04068 FoxO signaling pathway
    100768351 (Akt2)
   04072 Phospholipase D signaling pathway
    100768351 (Akt2)
   04071 Sphingolipid signaling pathway
    100768351 (Akt2)
   04024 cAMP signaling pathway
    100768351 (Akt2)
   04022 cGMP-PKG signaling pathway
    100768351 (Akt2)
   04151 PI3K-Akt signaling pathway
    100768351 (Akt2)
   04152 AMPK signaling pathway
    100768351 (Akt2)
   04150 mTOR signaling pathway
    100768351 (Akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100768351 (Akt2)
  09143 Cell growth and death
   04210 Apoptosis
    100768351 (Akt2)
   04218 Cellular senescence
    100768351 (Akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100768351 (Akt2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100768351 (Akt2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100768351 (Akt2)
   04620 Toll-like receptor signaling pathway
    100768351 (Akt2)
   04625 C-type lectin receptor signaling pathway
    100768351 (Akt2)
   04660 T cell receptor signaling pathway
    100768351 (Akt2)
   04662 B cell receptor signaling pathway
    100768351 (Akt2)
   04664 Fc epsilon RI signaling pathway
    100768351 (Akt2)
   04666 Fc gamma R-mediated phagocytosis
    100768351 (Akt2)
   04062 Chemokine signaling pathway
    100768351 (Akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100768351 (Akt2)
   04922 Glucagon signaling pathway
    100768351 (Akt2)
   04923 Regulation of lipolysis in adipocytes
    100768351 (Akt2)
   04920 Adipocytokine signaling pathway
    100768351 (Akt2)
   04929 GnRH secretion
    100768351 (Akt2)
   04915 Estrogen signaling pathway
    100768351 (Akt2)
   04914 Progesterone-mediated oocyte maturation
    100768351 (Akt2)
   04917 Prolactin signaling pathway
    100768351 (Akt2)
   04926 Relaxin signaling pathway
    100768351 (Akt2)
   04935 Growth hormone synthesis, secretion and action
    100768351 (Akt2)
   04919 Thyroid hormone signaling pathway
    100768351 (Akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100768351 (Akt2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100768351 (Akt2)
  09156 Nervous system
   04725 Cholinergic synapse
    100768351 (Akt2)
   04728 Dopaminergic synapse
    100768351 (Akt2)
   04722 Neurotrophin signaling pathway
    100768351 (Akt2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100768351 (Akt2)
  09149 Aging
   04211 Longevity regulating pathway
    100768351 (Akt2)
   04213 Longevity regulating pathway - multiple species
    100768351 (Akt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768351 (Akt2)
   05205 Proteoglycans in cancer
    100768351 (Akt2)
   05230 Central carbon metabolism in cancer
    100768351 (Akt2)
   05231 Choline metabolism in cancer
    100768351 (Akt2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100768351 (Akt2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100768351 (Akt2)
   05212 Pancreatic cancer
    100768351 (Akt2)
   05225 Hepatocellular carcinoma
    100768351 (Akt2)
   05226 Gastric cancer
    100768351 (Akt2)
   05214 Glioma
    100768351 (Akt2)
   05221 Acute myeloid leukemia
    100768351 (Akt2)
   05220 Chronic myeloid leukemia
    100768351 (Akt2)
   05218 Melanoma
    100768351 (Akt2)
   05211 Renal cell carcinoma
    100768351 (Akt2)
   05215 Prostate cancer
    100768351 (Akt2)
   05213 Endometrial cancer
    100768351 (Akt2)
   05224 Breast cancer
    100768351 (Akt2)
   05222 Small cell lung cancer
    100768351 (Akt2)
   05223 Non-small cell lung cancer
    100768351 (Akt2)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100768351 (Akt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100768351 (Akt2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100768351 (Akt2)
   04931 Insulin resistance
    100768351 (Akt2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100768351 (Akt2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100768351 (Akt2)
   05135 Yersinia infection
    100768351 (Akt2)
   05152 Tuberculosis
    100768351 (Akt2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100768351 (Akt2)
   05170 Human immunodeficiency virus 1 infection
    100768351 (Akt2)
   05162 Measles
    100768351 (Akt2)
   05164 Influenza A
    100768351 (Akt2)
   05161 Hepatitis B
    100768351 (Akt2)
   05160 Hepatitis C
    100768351 (Akt2)
   05168 Herpes simplex virus 1 infection
    100768351 (Akt2)
   05163 Human cytomegalovirus infection
    100768351 (Akt2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100768351 (Akt2)
   05169 Epstein-Barr virus infection
    100768351 (Akt2)
   05165 Human papillomavirus infection
    100768351 (Akt2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100768351 (Akt2)
   05142 Chagas disease (American trypanosomiasis)
    100768351 (Akt2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100768351 (Akt2)
   01524 Platinum drug resistance
    100768351 (Akt2)
   01522 Endocrine resistance
    100768351 (Akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100768351 (Akt2)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100768351 (Akt2)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100768351 (Akt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kinase-like Pkinase_C
Motif
Other DBs
NCBI-GeneID: 100768351
NCBI-ProteinID: XP_027286258
Position
9
AA seq 481 aa AA seqDB search
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEDPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRTIQMVANSLKHRDPGDNAL
EYKCGSPSDSSSSEMMEVAVNKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQR
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaggaaggctggctccacaagcgtggtgaatacatcaag
acttggaggccccggtacttccttctcaagagtgatggctctttcattgggtataaggag
aggcctgaggaccctgaccagaccttaccccccctgaacaatttttctgtcgcagaatgc
caactgatgaagactgagaggccacggcccaacacctttgtcatacgctgcctgcagtgg
accacggtcatcgagaggaccttccatgtagactctccagatgagagggaagagtggatg
cggactatccagatggtcgccaacagtctgaagcaccgggacccaggtgacaatgcctta
gagtataagtgtggctcccccagtgactcttcctcatctgagatgatggaggtggcggtc
aacaaggcacgggccaaagtgaccatgaatgacttcgattatctcaaactccttggtaag
ggcaccttcggcaaagtcatcctcgtgcgggagaaagccactggccgctactatgccatg
aagattctgaggaaggaagtcatcattgccaaggatgaagtcgcccacacggtcactgag
agccgggtcctgcagaacaccaggcaccccttccttactgccctgaagtatgccttccag
acccatgaccgcctgtgcttcgtaatggagtacgccaacgggggcgagctgttcttccac
ctgtctcgggagcgagtcttcacggaggatcgggcccgattttatggtgcggagatcgtg
tcagctctggagtatttgcactcgagggacgtggtgtaccgtgacatcaagctggaaaac
cttatgctggacaaagacggccacatcaagatcactgactttggcttgtgtaaagagggc
atcagtgacggggccaccatgaaaaccttctgcggcaccccagagtacttggcacccgag
gtgctggaggacaatgactacggacgtgcagtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgtggccgcctgcccttctacaaccaggatcacgagcgcctctttgag
ctcatcctcatggaggagatccgcttcccacggacgcttgggccggaggccaagtccctg
ctggctggactgctgaagaaggaccctaagcagaggctcggcggaggtcccagtgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggatgtggtacagaga
aagctcctaccacccttcaaacctcaggtcacttccgaagtggacacaaggtacttcgac
gatgagttcaccgcccagtcgatcacaatcacacccccggaccgctatgacagcctgggc
tcgctggaactggaccagcggacgcacttcccccagttctcctactcagccagcatccga
gagtga

KEGG   Cricetulus griseus (Chinese hamster): 100769460Help
Entry
100769460         CDS       T02813                                 

Gene name
Akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04261  Adrenergic signaling in cardiomyocytes
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04620  Toll-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04728  Dopaminergic synapse
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04920  Adipocytokine signaling pathway
cge04922  Glucagon signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04973  Carbohydrate digestion and absorption
cge05017  Spinocerebellar ataxia
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05145  Toxoplasmosis
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100769460 (Akt1)
   04015 Rap1 signaling pathway
    100769460 (Akt1)
   04010 MAPK signaling pathway
    100769460 (Akt1)
   04012 ErbB signaling pathway
    100769460 (Akt1)
   04370 VEGF signaling pathway
    100769460 (Akt1)
   04371 Apelin signaling pathway
    100769460 (Akt1)
   04630 Jak-STAT signaling pathway
    100769460 (Akt1)
   04668 TNF signaling pathway
    100769460 (Akt1)
   04066 HIF-1 signaling pathway
    100769460 (Akt1)
   04068 FoxO signaling pathway
    100769460 (Akt1)
   04072 Phospholipase D signaling pathway
    100769460 (Akt1)
   04071 Sphingolipid signaling pathway
    100769460 (Akt1)
   04024 cAMP signaling pathway
    100769460 (Akt1)
   04022 cGMP-PKG signaling pathway
    100769460 (Akt1)
   04151 PI3K-Akt signaling pathway
    100769460 (Akt1)
   04152 AMPK signaling pathway
    100769460 (Akt1)
   04150 mTOR signaling pathway
    100769460 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100769460 (Akt1)
  09143 Cell growth and death
   04210 Apoptosis
    100769460 (Akt1)
   04218 Cellular senescence
    100769460 (Akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100769460 (Akt1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100769460 (Akt1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100769460 (Akt1)
   04620 Toll-like receptor signaling pathway
    100769460 (Akt1)
   04625 C-type lectin receptor signaling pathway
    100769460 (Akt1)
   04660 T cell receptor signaling pathway
    100769460 (Akt1)
   04662 B cell receptor signaling pathway
    100769460 (Akt1)
   04664 Fc epsilon RI signaling pathway
    100769460 (Akt1)
   04666 Fc gamma R-mediated phagocytosis
    100769460 (Akt1)
   04062 Chemokine signaling pathway
    100769460 (Akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100769460 (Akt1)
   04922 Glucagon signaling pathway
    100769460 (Akt1)
   04923 Regulation of lipolysis in adipocytes
    100769460 (Akt1)
   04920 Adipocytokine signaling pathway
    100769460 (Akt1)
   04929 GnRH secretion
    100769460 (Akt1)
   04915 Estrogen signaling pathway
    100769460 (Akt1)
   04914 Progesterone-mediated oocyte maturation
    100769460 (Akt1)
   04917 Prolactin signaling pathway
    100769460 (Akt1)
   04926 Relaxin signaling pathway
    100769460 (Akt1)
   04935 Growth hormone synthesis, secretion and action
    100769460 (Akt1)
   04919 Thyroid hormone signaling pathway
    100769460 (Akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100769460 (Akt1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100769460 (Akt1)
  09156 Nervous system
   04725 Cholinergic synapse
    100769460 (Akt1)
   04728 Dopaminergic synapse
    100769460 (Akt1)
   04722 Neurotrophin signaling pathway
    100769460 (Akt1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100769460 (Akt1)
  09149 Aging
   04211 Longevity regulating pathway
    100769460 (Akt1)
   04213 Longevity regulating pathway - multiple species
    100769460 (Akt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769460 (Akt1)
   05205 Proteoglycans in cancer
    100769460 (Akt1)
   05230 Central carbon metabolism in cancer
    100769460 (Akt1)
   05231 Choline metabolism in cancer
    100769460 (Akt1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100769460 (Akt1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100769460 (Akt1)
   05212 Pancreatic cancer
    100769460 (Akt1)
   05225 Hepatocellular carcinoma
    100769460 (Akt1)
   05226 Gastric cancer
    100769460 (Akt1)
   05214 Glioma
    100769460 (Akt1)
   05221 Acute myeloid leukemia
    100769460 (Akt1)
   05220 Chronic myeloid leukemia
    100769460 (Akt1)
   05218 Melanoma
    100769460 (Akt1)
   05211 Renal cell carcinoma
    100769460 (Akt1)
   05215 Prostate cancer
    100769460 (Akt1)
   05213 Endometrial cancer
    100769460 (Akt1)
   05224 Breast cancer
    100769460 (Akt1)
   05222 Small cell lung cancer
    100769460 (Akt1)
   05223 Non-small cell lung cancer
    100769460 (Akt1)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100769460 (Akt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100769460 (Akt1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100769460 (Akt1)
   04931 Insulin resistance
    100769460 (Akt1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100769460 (Akt1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100769460 (Akt1)
   05135 Yersinia infection
    100769460 (Akt1)
   05152 Tuberculosis
    100769460 (Akt1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100769460 (Akt1)
   05170 Human immunodeficiency virus 1 infection
    100769460 (Akt1)
   05162 Measles
    100769460 (Akt1)
   05164 Influenza A
    100769460 (Akt1)
   05161 Hepatitis B
    100769460 (Akt1)
   05160 Hepatitis C
    100769460 (Akt1)
   05168 Herpes simplex virus 1 infection
    100769460 (Akt1)
   05163 Human cytomegalovirus infection
    100769460 (Akt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100769460 (Akt1)
   05169 Epstein-Barr virus infection
    100769460 (Akt1)
   05165 Human papillomavirus infection
    100769460 (Akt1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100769460 (Akt1)
   05142 Chagas disease (American trypanosomiasis)
    100769460 (Akt1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100769460 (Akt1)
   01524 Platinum drug resistance
    100769460 (Akt1)
   01522 Endocrine resistance
    100769460 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100769460 (Akt1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100769460 (Akt1)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100769460 (Akt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100769460
NCBI-ProteinID: XP_027272445
UniProt: G3H397
Position
5
AA seq 480 aa AA seqDB search
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEHRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtagccattgtgaaggagggctggctgcacaaacgaggggaatacattaaa
acctggcggccacgctacttcctcctcaagaatgacggcacctttattggctacaaggaa
cggcctcaggacgtggagcatcgagagtcccccctcaacaacttctcagtggcacaatgc
cagctgatgaagacagaacggccacgtcccaacaccttcatcatccgctgtctgcagtgg
accactgtcattgagcgcaccttccatgtggaaacacccgaggagcgagaagaatggacc
actgccatccagactgtggctgatggactcaagaggcaggaggaagagacgatggacttc
cgatcaggttctcccagtgacaactctggggctgaggagatggaggtgtccctggccaag
cccaagcatcgtgtgaccatgaacgagtttgagtacctgaaactcctgggcaagggcacc
tttgggaaggtgatcctggtgaaggagaaggccacgggccgctactatgccatgaagatc
ctcaagaaggaggtcatcgttgccaaggacgaggttgcccacacactcactgagaaccgc
gtcctgcagaactccaggcatcccttccttaccgccctgaagtactcattccagacccat
gaccgcctctgctttgtcatggaatatgccaatgggggcgagctcttcttccatctatcc
cgtgagcgtgtgttttccgaggaccgggctcgcttctatggtgcagagatcgtgtcagcc
ctggactatctgcactctgagaagaatgtggtataccgggacctgaagctggagaacctc
atgctggacaaggatgggcacatcaagataacagactttgggctgtgcaaggaagggatc
aaggatggtgccactatgaagaccttctgcggaacacctgagtacctggcccctgaggtg
ctggaggacaacgactatggccgtgcagtggattggtgggggctgggcgtggtcatgtat
gagatgatgtgtggccgcctgcccttctacaaccaggaccacgagaagctgttcgagctt
atcctcatggaggagatccgcttcccacgcacgcttggccctgaggccaagtccctgctc
tctgggctgctcaagaaagaccccacacagaggcttggcgggggctccgaggatgccaag
gagatcatgcagcaccgcttctttgccaacatcgtgtggcaggatgtgtatgagaagaag
ctgagcccacctttcaagccccaggtcacctctgagactgacaccaggtatttcgatgag
gaattcacagcccagatgatcactatcacaccgcctgatcaagatgacagcatggagtgt
gtagacagcgagaggaggccacacttcccccagttttcctactcagccagtgggacagcc
tga

DBGET integrated database retrieval system