KEGG   Cricetulus griseus (Chinese hamster): 100752736Help
Entry
100752736         CDS       T02813                                 

Gene name
Anxa11
Definition
(RefSeq) annexin A11
  KO
K17095  annexin A7/11
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100752736 (Anxa11)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100752736 (Anxa11)
  Exosomal proteins of other body fluids (saliva and urine)
   100752736 (Anxa11)
  Exosomal proteins of colorectal cancer cells
   100752736 (Anxa11)
  Exosomal proteins of bladder cancer cells
   100752736 (Anxa11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Ribosomal_S6e
Motif
Other DBs
NCBI-GeneID: 100752736
NCBI-ProteinID: XP_027244887
UniProt: G3HHA9
Position
1
AA seq 503 aa AA seqDB search
MSYPGYPPPAGGYPPAAPGGGPWGGAGYPPPSMPPIGLDNVANYAGQFNQDYLSGMATNM
SGTFGGANMPNLYPGAPGGAYPPVPPGGFGQPPPAQQPVPPYGMYPPPGGNPPPGMPSYP
AYPGAPVPGQPMPPPGQQPPGAYPGQPPMTYPGQSPMPPPGQQPVPSYPGYSGSSTVTPA
VPPAQFGNRGTITDASGFDPMRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSF
KTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDVYEIKEAIKGAGTDEACLIEILASR
SNEHIRELNRAYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQ
ELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNDYQRMTGRDIEKSICREMSGDLEQGM
LAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSELDLLDIRAEYKRMYGKSLY
HDITGDTSGDYRKILLKICGGND
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagctacccaggctaccccccacctgctggtggctaccctccagctgctccaggtggt
ggtccctggggaggtgctggctaccctcctcccagcatgcccccaatcgggctggataat
gtggccaactatgcagggcagttcaaccaggactacctctcaggcatggcaaccaacatg
tctgggacatttggaggagccaacatgccaaacctgtatcctggagctcctgggggtgcc
taccctccagtcccacctggtggctttgggcagccccctcctgcccagcagcctgtccct
ccttatggaatgtatccacccccagggggaaacccaccacctgggatgccctcatatcca
gcatacccaggggctcctgtgccaggccagcccatgccaccccctgggcagcagccccca
ggggcctatcctggacagcctccaatgacctatcctggacagtcaccaatgccaccccct
gggcagcagccagtgccaagttacccaggatactcaggatccagtaccgtcacccctgct
gtgcctccagcccagtttggaaaccgaggcaccattacagatgcttctggatttgacccc
atgcgagatgctgaggtccttcggaaggccatgaagggctttggaactgatgaacaggcc
atcatcgactgcctagggagccgttctaacaagcagaggcagcagatcctcctgtccttt
aagacagcctatggcaaggatttgatcaaagacctaaaatcagaactgtcaggaaacttt
gagaagactatcctggccctgatgaagaccccggtcctgtttgatgtctatgagataaag
gaagccatcaagggggccggtactgatgaggcctgcctgattgaaatcctcgcttcccga
agtaacgaacacatccgggaactaaacagagcctacaaaacagaattcaaaaagactttg
gaggaggccattcgaagtgacacatcaggacacttccagcggctcctcatctctctctct
cagggaaaccgtgacgagagcacaaatgtggatatgtccctagtccagagagatgtccag
gagctgtatgcagctggagagaaccgcctaggaacagatgagtccaagttcaatgcgatt
ctgtgctcccggagtcgggcccacctggtggcagttttcaacgattaccagaggatgact
ggccgagatatcgagaagagcatctgccgggagatgtctggggacctggagcagggcatg
ctggctgtggtgaaatgcctgaagaacactccagccttctttgctgaaaggctcaacaag
gctatgcggggagcaggaacaaaagaccggaccctgattcgaatcatggtgtctcgaagt
gagctcgacctcctggatatccgagcggaatataagcggatgtacggcaagtcgctgtac
catgacatcacgggagacacttctggggactatcggaagattctactgaagatctgtggt
ggcaacgactaa

DBGET integrated database retrieval system