KEGG   Cricetulus griseus (Chinese hamster): 100754328
Entry
100754328         CDS       T02813                                 

Gene name
Nr0b1
Definition
(RefSeq) nuclear receptor subfamily 0 group B member 1
  KO
K08562  nuclear receptor subfamily 0 group B member 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04927  Cortisol synthesis and secretion
Brite
KEGG Orthology (KO) [BR:cge00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100754328 (Nr0b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100754328 (Nr0b1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cge03310]
    100754328 (Nr0b1)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX1-like
    100754328 (Nr0b1)
Nuclear receptors [BR:cge03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   100754328 (Nr0b1)
SSDB
Motif
Pfam: NR_Repeat Hormone_recep
Other DBs
NCBI-GeneID: 100754328
NCBI-ProteinID: XP_027288610
UniProt: G3HXG4
Position
X
AA seq 474 aa
MAGEDHPLQGSILYNLLMSAKQKHAAAPVEPKVRLGVQCWGCACGAQSIGDEEGLPGGQT
SSLLYRCCLCGENHPRQGSILYSMLTSAKQSGSGTQASRARFGAPCWGCACGSPEPLVSR
EGTPARRAASLLYRCCFCGEEHPKQGSILYSLLTSAKQTHVSPEASEARRGGEWWQLSYC
TESMDDPEGLQSAQAMAFLYRSYVCGEEQPQQSSLACGTPGSSDQLPRAPEEQPRALWWD
ASSGVQRPLTLKNPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLML
ELAQDHLHIEMMEISEPSVLQKTLTTRQQETQGAEPADPLAKEQPQMVSTAEAGHLPSAA
AIQAIKSFFLKCWSLNIDTKEYAYLKGAVLFNPDLPGLQCVKYIQGLQWRTQQILTEHIR
VMQREYQIRSAELNSALFLLRFINTDVVTELFFRPIIGAVSMDDMMLEMLCAKL
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggcgggtgaggaccacccgttgcagggcagcatcctctacaatttactgatgagcgcg
aagcagaagcacgcggctgctccagtagagcccaaggtgcgcttgggggttcagtgctgg
ggttgtgcctgcggtgctcagtccatcggggacgaggagggactgcccggagggcaaacc
tcgtccctcctgtaccgctgctgcctttgcggggagaaccacccgcgccagggcagcatc
ctctactctatgctcactagcgccaagcagtcaggctcagggacccaggcgtccagggcg
cgattcggagccccgtgctggggctgtgcctgcggcagccccgaacccctggtgagtaga
gaggggacaccggccaggcgggcagcctcgctcctgtaccgctgttgcttctgcggagaa
gagcacccgaagcagggcagcatcttgtacagcttgctcactagcgccaagcagacgcac
gtgtctccggaagcgtccgaggcacgtcgcggaggcgaatggtggcagctgtcttactgt
acggagagtatggatgacccagaggggctgcagagcgcacaggccatggcgttcttgtac
cgcagctacgtgtgcggtgaagagcagccccagcagagcagcttagcctgtggcacaccc
gggagctcagatcaactgccccgggctccggaagagcagcctagggccctctggtgggac
gcctcttctggagtgcagcgtccgttgactctcaagaatccacaggtggtgtgcgaggca
gcatcggctggcctgctgaagacactgcgctttgtcaagtacttgccctgtttccagata
ctgcccctggatcagcagctggtgctggtgcggagctgttgggcgcccctactcatgctt
gagctggcccaggatcacctgcacatcgaaatgatggagatctccgaacctagcgtactg
cagaagacgctcaccaccaggcagcaggagacccagggtgctgagcccgcagatcccctg
gccaaagagcagccacagatggtgtccactgcggaggctggacacctgccctcggccgcc
gcgatccaagccataaagagcttctttctcaagtgctggagtctgaacatcgataccaag
gaatatgcctatctgaagggggccgtgctctttaacccagacctgcccggcctgcagtgt
gtgaaatacatccagggccttcagtggagaactcaacagatcctcactgagcacatcagg
gtgatgcagagagagtaccagatcagatccgctgaactgaatagtgcccttttcctgctg
agattcatcaatactgatgtcgtcactgaactctttttcagacctatcattggtgcagtc
agcatggatgatatgatgctggaaatgctctgtgcaaagttgtga

DBGET integrated database retrieval system