KEGG   Cricetulus griseus (Chinese hamster): 100754996Help
Entry
100754996         CDS       T02813                                 

Gene name
Aldh6a1
Definition
(RefSeq) methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00280  Valine, leucine and isoleucine degradation
cge00410  beta-Alanine metabolism
cge00562  Inositol phosphate metabolism
cge00640  Propanoate metabolism
cge01100  Metabolic pathways
cge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100754996 (Aldh6a1)
   00562 Inositol phosphate metabolism
    100754996 (Aldh6a1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100754996 (Aldh6a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100754996 (Aldh6a1)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     100754996 (Aldh6a1)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     100754996 (Aldh6a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 100754996
NCBI-ProteinID: XP_027274301
Position
5
AA seq 536 aa AA seqDB search
MAAVAAAAAAAAVRTRILQVSSKVNTWHLASSFSSSSVPTVKLFIDGKFVESKSDRWIDI
HNPATNEIIGRVPQSTKAEMDAAVAACKRAFSAWADTSILSRQQVLLRYQQLIKENLKEI
AKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLLMGETMPSITKDMDLYSYRLPLGVC
AGIAPFNFPAMIPLWMFPMAIVCGNTFLMKPSERVPGATMLLAKLFQDAGTPDGALNIIH
GQHEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRNGKRVQANMGAKNHGVVMPDANKE
NTLNQLVGAAFGAAGQRCMALSTAILVGEAKKWLPELVDRAKNLRVNAGDQPGADLGPLI
TPQAKERVCSLIDSGTKEGATILLDGRKIKVKGYENGNFVGPTIISNVKPSMTCYKEEIF
GPVLVVLETETLDEAIKIVNDNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVPL
PMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggcggcggcggcggcggcggcggcagtgcggacccggatcctgcaggtt
tcttctaaagtaaacacgtggcatctggcatcctccttttcttcatcatcagtgccaact
gtaaaactcttcattgatgggaaatttgttgaatccaaaagcgacagatggattgatatc
cacaacccagctaccaatgaaatcatcggtcgggtacctcagtccaccaaagctgaaatg
gatgcagctgttgctgcctgcaaacgtgctttctctgcatgggcagacacatccatttta
agccgtcagcaggtcctgctccgctatcaacaacttattaaagaaaacctgaaagaaatt
gccaagttaatcacattggaacaagggaagactctagctgatgctgaaggagatgtattc
cgaggccttcaggtggttgagcatgcctgtagtgtgacatccctcctgatgggagagacc
atgccatctatcaccaaagacatggacctttattcctaccgtctgcctctgggtgtgtgt
gcaggcattgcaccatttaatttccctgccatgatccccctttggatgtttcccatggct
atagtttgtggaaatactttcctaatgaaaccatcagagagagtacctggagcaactatg
ctccttgctaaattgtttcaggatgctgggacccccgacggagccctgaacatcatccat
ggacagcatgaagctgtgaattttatttgcgatcacccagacatcaaagcaatcagtttt
gtgggctccaaccaggcaggagagtatatctttgaaagagggtcaagaaatggcaagaga
gttcaagccaatatgggagccaaaaatcatggagtagtcatgccagatgccaataaggaa
aatacactaaaccaactggtcggggctgcatttggagctgctggccaacgctgcatggct
ctttcaacagccatccttgtcggagaagctaaaaaatggctgccagagctggtggaccgt
gccaaaaacctgcgagtcaatgcaggggaccagcctggagctgatcttggccctctgatc
accccccaagccaaagagcgagtctgcagtctgatagatagtggaacaaaagagggagct
accatccttttggatgggcgaaaaattaaagtcaaaggctatgaaaatggtaactttgtt
ggaccaaccatcatctccaatgtcaagccaagtatgacctgttacaaagaggagattttt
ggtccagttcttgtggttctggagacagagacattggatgaagccatcaagattgtaaat
gacaacccatatggaaacggaactgccatctttactaccaatggagccactgcacggaaa
tactctcacttggtggatgttgggcaggtgggcgtcaatgtccccattccagtgcctttg
cccatgttctccttcaccggctctcgatcttccttcaggggagacaccaatttctatggc
aaacagggcatccagttttacactcagcttaagactatcacatctcagtggaaagaagag
gatgctactctttcctcacctgctgtagtcatgcctaccatggggcgttag

DBGET integrated database retrieval system