KEGG   Cricetulus griseus (Chinese hamster): 100755459Help
Entry
100755459         CDS       T02813                                 

Gene name
Elk4
Definition
(RefSeq) ETS domain-containing protein Elk-4
  KO
K04376  ETS domain-containing protein Elk-4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge05166  Human T-cell leukemia virus 1 infection
cge05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100755459 (Elk4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100755459 (Elk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100755459 (Elk4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100755459 (Elk4)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100755459 (Elk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 100755459
NCBI-ProteinID: XP_027273449
UniProt: G3HAY2
Position
5
AA seq 430 aa AA seqDB search
MDSAITLWQFLLQLLQEPQNEHMICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLS
RALRYYYVKNIIKKVNGQKFVYKFVSYPEILKMDPLTVGRIEGDCETLNSLDASSSKDAE
SGAKERAPQPAARTSSRNDYIHSGLYSSFTLNSLNTSNKKLFKSIKIENPAEKLAEKKTQ
EPTPSVIKFVTTPAKKPPIEPVAVTFSTSPSISPSSEETIQALETLVSPTLPSLEAPASA
SILATTFNPTPPVPSVPLPPKEPPRTPSPPLSSNPDIDTDIDSVASQPMELPENLSLEPK
NEDSAVPEKDKTNNSSRSKKPKGLELTPALVVTGSDPSPLGILSPSLPTASLTPALFSQT
PILLTPSPLLSSIHFWSTLSPFAPLSPARLQGANTLFQFPSVLNSHGPFTLSSLDGPSTP
GPFSPDLQKT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgccatcactctgtggcagttccttcttcagctcctgcaggagcctcagaac
gagcacatgatctgctggacatctaacaatggggagttcaagcttctgcaagctgaggag
gtggctcgtctctgggggattcgaaagaacaagcctaatatgaattacgataagctcagc
agagccctgagatactactacgtaaagaacatcattaaaaaagtgaatggtcagaagttt
gtgtacaagtttgtctcttatccagagattttgaaaatggatccactgacagtaggcagg
atagagggagactgtgaaactttaaattcccttgacgccagcagttccaaagatgctgag
agtggggcaaaggaacgggcacctcagcctgcagccaggacatctagtcgcaatgactac
atacattctggtttgtactcttcatttactctcaactctttgaacacctccaataagaag
cttttcaagtcaatcaagatagagaatccagctgaaaaactggcagagaaaaaaactcag
gagccaacaccatctgtcatcaaatttgtaacaacacctgccaaaaagccacccatcgaa
cctgttgctgttaccttttcaacaagcccaagtatttctccctcttctgaagaaactatc
caagctttggagacactggtttctcccacactgccttctctggaagccccagcctctgca
tccattctggctaccacctttaaccccactcctccagttccatccgtaccccttccccca
aaggagcctcctaggacgccttctccaccactgagttctaacccagacattgacacagac
attgactcagtggcgtctcagccaatggaacttccagagaacttgtcattggagcctaaa
aatgaggattcagctgtgccagaaaaggacaaaacaaataactcttcgagatccaagaag
cccaaagggttagaactgacacccgcccttgtggtcacaggcagtgaccccagccccctg
gggatcttaagtccatctctcccaacagcgtctctcacaccagcacttttttcacagaca
cccatcttgctgactccaagccccttgctctccagtatccacttttggagcactctcagc
ccattcgctcccctgagcccagccagactgcaaggtgctaatacgcttttccagtttcct
tctgtgctcaacagtcatggaccattcactctgtctagcctggatggaccttccactccc
ggcccgttttctccagacctacagaagacataa

DBGET integrated database retrieval system