KEGG   Cricetulus griseus (Chinese hamster): 100755500
Entry
100755500         CDS       T02813                                 

Gene name
Nfya
Definition
(RefSeq) nuclear transcription factor Y subunit alpha isoform X1
  KO
K08064  nuclear transcription factor Y, alpha
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04612  Antigen processing and presentation
cge05017  Spinocerebellar ataxia
cge05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100755500 (Nfya)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100755500 (Nfya)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100755500 (Nfya)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100755500 (Nfya)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    100755500 (Nfya)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
NCBI-GeneID: 100755500
NCBI-ProteinID: XP_027250326
UniProt: G3I9V5
Position
1
AA seq 347 aa
MEQYTTNSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV
QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL
QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV
PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH
ESRHRHAMARKRGEGGRFFSPKEKDGPHIQDPNQADEEAMTQIIRVS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagcagtataccacaaacagcaatagttccacagagcagatcgtggtgcaggctggc
cagattcagcagcagcagcagggtggtgtcactgctgtccagttgcagactgaggcccag
gtggcatccgcctcaggccagcaagtccagaccctccaggtagtccagggacagccatta
atggtacaagtcagtggaggccagctaattacatcaactggccaacccatcatggtccag
gctgtgccaggtggacaaggccaaactattatgcaggtacctgtgtctggaacacaaggc
ttacagcagatacagttggtcccccctggtcaaatccagatccagggtggacaggctgtg
caggtgcaaggccagcagggtcagacccagcagatcatcattcaacagccacagactgca
gtcaccgctggccagactcagacacaacagcagattgctgtccagggacaacaagtggcc
cagactgctgaagggcagactattgtctaccagccagttaatgcagatggcacaattctc
cagcaagttacagtccctgtttcaggcatgatcaccattccagcagccagtttggcagga
gcacagatcgttcagacaggagccaataccaacacaaccagcagtggacaagggactgtc
actgtgacactgccagtggcaggcaatgtggtcaactcaggaggaatggtcatgatggtg
ccaggagctggctccgtgcctgctatccagagaatccctttacctggagcagaaatgctg
gaagaagagcccctgtatgtgaatgccaagcaatatcaccgaatccttaagaggagacaa
gcacgggctaagctagaggcagaagggaaaatcccaaaggaaagaaggaaatacctccat
gagtctcggcatcgacatgccatggcacggaagcgtggtgaagggggccggttcttctct
ccaaaggaaaaggatggtcctcatattcaggatccgaaccaagctgatgaagaagccatg
acacagattatccgagtttcctaa

DBGET integrated database retrieval system