KEGG   Cricetulus griseus (Chinese hamster): 100756235
Entry
100756235         CDS       T02813                                 

Gene name
Erap1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cge01002]
    100756235 (Erap1)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100756235 (Erap1)
Peptidases and inhibitors [BR:cge01002]
 Metallo peptidases
  Family M1
   100756235 (Erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100756235
NCBI-ProteinID: XP_027257655
Position
2
AA seq 941 aa
MVSLPLKWPLESMPSLLSLLLIILAVSSPSWCQSSDTAFPKASNGSPFPWNNVRLPEHII
PIHYDLMIHANLSTLTFWGTTEVEITVSQPTSTIIMHSHQLQISKATLRRGAEDKQSEEP
LSILEYPANEQVALLAPQPLLAGPLYTVIITYAANLSESFHGFYKSTYRTQEGEIRVLAS
TQFEPTAARMAFPCFDEPALKASFSIKIRRDPRHLAISNMPLVKSVNVAEGLIEDHFDVT
VKMSTYLVAFIVCDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEEHFFGKCFNAMEVDAFNSSHPV
STPVENPAQIREMFDGVSYEKGACILNMLRDYLGADTFKRGIVQYLQKYSYKNTKNEDLW
NSMASICPTDGTQTMDGFCSRSQHSSSTSHWHQEGIDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYMKGSESLPETGYLWHVPLTFITSRSKSVQRFLLKTKTDVLILPEAVEWIK
FNVGMNGYYIVHYEDDGWDSLSGLLKIAHTTISSNDRASLINNAFQLVSIGKLSIEKALD
LTLYLKDETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLLRLLKDLIDKQIWTDE
GSVSQRMLRSQLLLLACVRKYQPCVQRAEGYFREWKASNGTMSLPVDVTMAVFAVGAQNT
EGWDFLYSKYQSSLSVTEKSQIEFALCTSQDPEKLQWLLDESFKGDTIKTQEFPHILILI
GRNPVGYPLAWKFLRENWNKLVQKFELGSTTISYMVLGTTDQFSTRARLEEVKGFFSSLK
ENGSQLRCVQQTIEAIEENIRWMEKNFEKIRLWLQKEKLEI
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtgtctctgcctctcaaatggccacttgaaagcatgccttctctactttccttacta
ttgattattttagctgtgtcatctccttcttggtgtcagagcagtgatacagcatttcca
aaagcaagtaatgggtccccattcccttggaataacgtacgacttcctgagcatatcatt
ccaattcattatgatctcatgatccatgcaaacctcagcactctgaccttctggggaaca
acagaagtggaaatcacagttagtcagcccacaagcaccattatcatgcatagtcaccag
ctacaaatatctaaggccaccctcaggagaggagctgaagacaagcagtctgaagaacca
ctgagcatcctggagtaccctgctaatgaacaagttgcactgctggctccccagccactc
cttgctggacccctgtacacagttatcatcacctatgccgccaacctgtctgagagcttc
catggattttataaaagcacatacagaacccaagaaggggaaataagagtacttgcatca
acacagtttgaacccacagctgctcgaatggcctttccctgctttgatgagcctgcactc
aaggcaagtttttccatcaagataaggagagatccaaggcacctggccatctccaacatg
cccttggtgaaatctgtgaatgttgctgaaggactcatagaagatcattttgatgtcact
gtgaagatgagcacctacctggtggccttcattgtttgtgattttaagtctgtgagcaag
atgacgaagagtggagtcaaggtttctgtgtatgctgtgccagacaagataaatcaagca
gattatgctctggatgctgcagtcactcttctagaattctatgaggattacttcagtatt
ccatatcctttacccaagcaagatcttgctgcaattcctgactttcagtctggtgctatg
gagaactggggcctgaccacatacagagaatcctctctgttatatgataaagaaaagtct
tctgcatccagtaaacttggcatcacaatgactgtgtcccatgaacttgctcaccagtgg
tttgggaatctggtcaccatggaatggtggaatgacctttggctcaatgaaggatttgcc
aagtttatggagttcgtgtctgtcactgtgacccatcctgaactgaaagttgaagagcat
ttctttggcaagtgttttaatgcaatggaagtcgatgcattcaactcctcacaccctgta
tccacacctgtggagaatcctgcacagattcgggagatgtttgatggtgtttcttatgaa
aagggtgcttgtattctgaatatgctaagagattatctgggtgcagacacatttaaaaga
ggaattgtgcagtatcttcagaagtatagttataaaaacacaaaaaatgaggacctctgg
aacagcatggcgagtatttgtcccacagatggcacgcaaacaatggatggtttttgctct
agaagccagcattcatcatcaacatcacactggcatcaggaaggcatagatgtgaaaacc
atgatgaacacatggacactgcagaagggctttcccctgataaccatcaccgtaagaggg
cgaaatgtgcacatgaagcaagaacattacatgaagggttctgaaagcctcccagagact
gggtacctgtggcatgttcccctgacattcattaccagcaggtcaaagtcagtccagagg
tttttgctgaagacaaagaccgatgtgctcatcctcccggaagcagtagagtggatcaaa
tttaatgtgggaatgaatggctattacattgttcactatgaggatgacggatgggactct
ctgagtggccttttaaaaattgcacacacgacgatcagcagtaatgaccgggcaagtctc
atcaacaatgcatttcagcttgtcagcattgggaagttatccattgaaaaagccctggat
ttaaccctgtacttgaaagatgaaacagaaattatgcctgtattccaaggtttgaatgaa
ctgatacctatgtataagttaatggagaaaagagatatgaatgaggtggaaactcaattt
aaggccttcctactcaggctgctgaaggaccttattgataagcagatatggacagatgag
ggctctgtatcacagaggatgctcaggagccagctcctcctccttgcatgtgtgcgcaag
tatcagccctgtgtgcagagggcagagggctatttcagagagtggaaggcatccaatgga
accatgagtctccctgtcgatgtgaccatggcagtgtttgctgtgggtgcccagaacaca
gaaggctgggattttctttatagtaaatatcagtcatctttgtctgttactgaaaaaagc
caaattgaatttgccctctgcacaagccaagacccagaaaagcttcagtggcttctagac
gaaagtttcaagggagatacaataaaaactcaggaatttccacatattctcatactaatt
ggcaggaatccagtgggctatccattggcctggaagtttctgagggaaaattggaataaa
cttgtacaaaagtttgaacttggctcaacgaccatatcttacatggtactgggaacaaca
gaccagttttccaccagagcacgtctggaagaggtaaaaggattctttagctccttgaaa
gaaaatggctctcagctccgatgtgttcaacaaaccattgaggccattgaggaaaacata
cgatggatggagaagaatttcgaaaaaatccgattatggctgcaaaaagaaaagctggaa
atatga

DBGET integrated database retrieval system