KEGG   Cricetulus griseus (Chinese hamster): 100756505
Entry
100756505         CDS       T02813                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X3
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100756505
Transcription factors [BR:cge03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100756505
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 100756505
NCBI-ProteinID: XP_027255970
Position
2
AA seq 702 aa
MMIPSGECTYAGRKRRKPIQKRRLTMGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIIC
KLDKLSVLRLSVSYLRVKSFFQALQETCVWPAPTLPPEDHSHRGFPVQEGRLLLESLNGF
ALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVF
GQSPHADTDNTILGKLLRAQERGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQKKKAPSGTALPPRLSLFCIVVPVLPSVAEMKVKSAFLRAKHRADIVVTVDSRV
KAVTSLCESELHPKPNYLAGKSNGENGISLFRGQIDKSHWARALARPSCLCLRGGPDLLL
DPRGASGDKEEEDQKHVLRRSTGARGQREMHKYNYGLETPAHLRHLNWSTEQRSQEVTTK
LTRQPSKNEPSTCQMPHGSCMPYHGSQGMFSASSMASFKDLPDHPTGAYCSQMNRPLQDI
HQGQVHPSTCHIPQGSLGSRIPLPGMQRFTARGFSTEDAKLSSLPVTIDTPCNPVLSLEV
PIKMENESGSQDIVDASTTSRVWLGASDMARRHLVSFPARMHLKTEPDYRQQVCTPHLGH
GMLVTNAHSRDTVGSCREQAPLHPAHCTCLDPEPPHHLFMRGHSESQHPSLVQDCSAPIV
KSEPLDSPSWAGPGQVAVPRMFPKSTSITVIPPKGSDGIFLP
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgatgattccatcaggagagtgtacatatgctggcaggaagagaaggaaacccattcag
aagcggaggcttaccatgggggctgagaaatcaaatccttccaaacggcaccgggaccgc
ctcaatgcagagctggaccacctggccagcctgctgccatttccacctgatatcatctgc
aagctggacaagctttccgtcctgcgcctcagcgttagttacctcagggtgaagagcttc
ttccaagccttgcaggagacatgtgtatggccagctccaaccctgccacctgaagaccac
tcacacagagggttccctgtgcaggagggacggctgctgctggagtctctcaatggcttt
gctctggtggtgagtgcagaagggatgatcttttatgcatcggcaacaattgtggactat
ctgggcttccatcagacagacgtaatgcaccaaaacatttatgactacatccatgtggat
gatcgacaggacttctgtagacagctacactgggccatggaccctccacaggtggtgttt
ggacagtctccacatgcagacacagacaataccatccttgggaagttgctcagggctcag
gaacggggcaagggcttgccctcagaatactcggccttcttgacacgctgcttcatctgt
cgtgttcgatgtttgctggacagcacctctggctttctgactatgcagttccaaggaaaa
ctaaaattcctgtttggacagaagaagaaggcgccatcaggaacagccctgccccctcgg
ctctcgttgttttgcattgtggtgccagtcctgccttctgtggctgagatgaaagtgaaa
agtgcattcttgagggcgaagcacagggcagacattgtggttacagtggactcaagggta
aaagctgttacaagtctgtgtgaatcagaattgcatcccaaacccaattacttagcagga
aagagcaatggagaaaatggcatttcactgttcaggggacaaatagataagagccactgg
gcccgggccctagccaggccttcatgtctgtgcctcagaggtggtcctgatctcctcctg
gaccccaggggggcttcaggggacaaagaagaagaggaccagaagcatgtactaaggaga
tccactggtgccaggggtcagagggagatgcacaagtacaattatggcttggaaacacca
gcacacttgaggcacctgaactggagcacagaacagagaagtcaggaggtcactaccaag
ctgactcggcagcccagtaagaatgagccatccacatgccaaatgccccatggttcctgt
atgccctatcatggaagccagggcatgttcagtgccagcagtatggcttctttcaaagat
ttaccagatcatcccactggtgcctactgcagccaaatgaatagacccttgcaagatatc
caccagggccaggtacatccttccacctgtcatatcccccaaggcagcctgggatccagg
atccctctgcctggaatgcagcgcttcacagccaggggattttctacagaggatgcaaaa
ttgtccagcctgccagtcaccatagacaccccatgcaatccagtattgtcactggaagtg
ccaatcaagatggaaaatgaatctgggtcccaggatatagttgatgccagcacaactagt
cgggtatggctgggagctagcgacatggccaggagacatctggtcagtttccctgccagg
atgcacctgaaaacagagcccgactataggcaacaggtctgtaccccacaccttgggcat
ggtatgctggtaactaatgcccacagcagagatactgttggatcctgcagggaacaagct
cctctccatcctgcacattgcacctgcctggatccagagcctcctcatcacctcttcatg
cggggccacagtgagagccaacatccctctttggtccaagactgcagtgctcctattgtt
aagagtgaacccctggattcgccatcatgggctggtcctggccaggtggctgtgcctagg
atgttccctaagagtacctctataactgtgatcccacccaaaggctctgatgggattttc
ctaccctag

DBGET integrated database retrieval system