KEGG   Cricetulus griseus (Chinese hamster): 100756755Help
Entry
100756755         CDS       T02813                                 

Gene name
Mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00450  Selenocompound metabolism
cge00970  Aminoacyl-tRNA biosynthesis
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100756755 (Mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100756755 (Mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cge01007]
    100756755 (Mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cge03016]
    100756755 (Mars)
Enzymes [BR:cge01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100756755 (Mars)
Amino acid related enzymes [BR:cge01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100756755 (Mars)
Transfer RNA biogenesis [BR:cge03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100756755 (Mars)
 Prokaryotic type
   Other AARSs
    100756755 (Mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C Anticodon_1 GST_C_2 GST_C_3 GST_N_2 GST_N
Motif
Other DBs
NCBI-GeneID: 100756755
NCBI-ProteinID: XP_027248025
Position
1
AA seq 908 aa AA seqDB search
MRLFVSEGSPGSLPVLAAAARARGRAELLISTVGPEECVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPVLSAALHCLVVQGKKGEDILGPLREA
LTHIDHSLSRQHCPFLVGDTESLADIVLWGALYPLLHDPTYLPEELGALQSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPRPPEGRAVSNEPEEEELATLSEEDILMAVTAW
EKGMGSLPPLQPQQHPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHAIHADVYRWFNISFDTFGRTTTP
HQTKITQDIFQRLLTRGFVLQDTVEQLRCEQCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAIELKKPQCKVCRSRPVVRSSQHLFLDLPKLEKRLEDWLGKTLPGSDWTPNARF
ITRSWLRDGLKPRCITRDLKWGTPVPLEGFKDKVFYVWFDATIGYLSITANYTDQWERWW
KNPEQVDLYQFMAKDNVPFHGIVFPCSALGAEDNYTLVKNLIATEYLNYEDGKFSKSRGI
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDMMIKNNSELLNNLGNFINRAGMF
VSKFFGGCVPEMVLTQDDRRLLAHISWELQHYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGSEVDRQRAGTVTGVAVNIAALLSVMLQPYMPTVSATIQTQLQLPLLACRV
LVTNFICTLPAGHQIGTVSPLFQKLENDQIENLRQRFGGGQLEESLELKTKGSPKPAVVE
EVTTAGPQQIQMLMDEVTKQGNIVRELKAQKADKNQVAAQVTKLLELKKQLALAEGKPIE
TPKGKKKK
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttcgtgagcgagggctccccggggagcctgccagtgctggctgcggccgcg
agggcccggggccgagcggagctgctcatcagcaccgtaggccccgaagagtgtgtggta
ccattcctgacccgacctaaggtccccgtcttgcagctggatagtggcaactacctcttc
tctaccagtgcaatctgccgatatttttttctgttatctggctgggagcaagatgacctt
accaaccagtggctagagtgggaagccacagagctccagccagttttgtctgctgcctta
cactgtttagtggttcaaggcaagaaaggggaagacatacttggcccacttcgggaagcc
ctaactcacattgatcacagcttgagtcggcaacactgtccgttcctggttggggacaca
gaatctctagctgacattgttttgtggggagcgctatatccgttactgcatgacccaact
tacctccctgaggaattgggtgccctgcagagctggttccagacactgagtacccaggag
ccatgtcagagagctgcagagactgtgctgaaacagcagggtgtcctggctctgcgcccc
tacctccaaaaacagccccagccccgccctcctgaggggagagctgtcagcaatgaacct
gaggaggaggagctggctaccctgtcagaggaggacatcctcatggctgtgactgcttgg
gaaaagggcatgggaagcttgcccccacttcagccacagcagcatccagtgttgcctgtg
gctggagagaggaatgtgctcatcacgagtgccctcccttacgtcaacaatgtccctcat
cttggaaacatcattggctgtgtgctcagtgctgatgtctttgcaaggtactcccgcctc
cgccagtggaataccctctatctatgtggtacagatgagtatggtacagcgacagagacc
aaggctatggaagagggtctcaccccacaggaaatctgtgacaaataccatgccattcac
gctgacgtctaccgctggtttaatatctcatttgatacttttggtcgcaccaccactcca
caccagaccaaaatcacccaggacatcttccaaaggttgctgacacggggttttgtgctg
caagatactgttgagcagctgcggtgtgagcagtgtgcgcgcttccttgctgaccgcttt
gtggagggcgtgtgtcccttctgtggctatgaagaggcccgaggtgaccagtgtgacaag
tgtggcaagctcatcaatgccattgaacttaagaagccgcaatgcaaagtctgccggtca
cgccctgtggtgaggtcctctcagcacctgtttctggacttacctaagttggaaaagcga
ctggaagactggctagggaagacattgcctggcagtgactggacacccaacgctcggttt
attactcgttcttggcttcgagatggcctcaagccacgatgcataaccagagacctcaaa
tggggaacacctgtgcccttggaaggtttcaaggacaaggtattttatgtctggtttgat
gccaccattggctacctgtccatcacagccaactatacagaccagtgggagagatggtgg
aagaatccagaacaagtggacctttaccagttcatggcgaaagacaatgttcccttccat
ggtatagtctttccttgttcggctctaggagctgaggacaattacaccttagtgaagaac
ctcattgctacagagtacctgaattatgaggatgggaaattctctaagagccgggggata
ggagtgtttggagacatggcccaggatacagggatccctgctgacatctggcgcttttat
ctgctgtacattcggcctgagggccaggacagtgccttctcctggacagacatgatgatt
aaaaacaattctgagctgctcaacaacctgggcaacttcatcaacagagctggcatgttt
gtgtctaagttttttgggggctgcgtgcctgagatggtgcttacccaggatgacagacgt
ctgctggcccatatctcctgggaactccagcactatcaccagctgctggaaaaggttcgg
atccgagatgccttgcgcagtatccttaccatatctcgacatggcaaccaatacattcaa
gtgaatgagccctggaaacggattaaaggaagtgaggtggacaggcagcgggcaggcaca
gtgacaggtgtggcagtaaacatagctgccttgctgtctgtcatgctccagccttacatg
ccaacagttagcgccaccatccagacccagctacagcttccactgctagcctgccgcgtc
cttgtcacaaacttcatttgtaccttaccagcaggtcatcagattggcacagtcagtcct
ttgttccaaaaattggaaaatgaccagattgaaaatttgaggcagcgctttggagggggc
cagctagaagagtccttggagttaaagactaaaggatcccccaagccagcagttgtggag
gaagttacaacagctgggccacagcagatacaaatgctgatggatgaagtgaccaaacag
ggcaacattgtccgagaactgaaagcacaaaaggcagacaaaaaccaggttgctgcacag
gtgactaaactcttggagctaaagaaacagttggctttggctgaagggaaacccattgaa
actcctaaaggcaagaagaaaaaatga

DBGET integrated database retrieval system