KEGG   Cricetulus griseus (Chinese hamster): 100757085Help
Entry
100757085         CDS       T02813                                 

Gene name
Dock8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X2
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100757085 (Dock8)
Membrane trafficking [BR:cge04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100757085 (Dock8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 100757085
NCBI-ProteinID: XP_027262292
Position
3
AA seq 2127 aa AA seqDB search
MATLPSAERRAFALKINRYSSSEIRKQFTLPPNLGQYHRHSISASGFPTLQLPQLYEPVE
PVDFEGLVMTHLDSLDAELAQELGDLTDDDLHVAFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGSSEFCSFKKTGSRRDFHKTLQKQTFESETLECSEPAAQTGPR
QLKVLCDVSEKGPLTTCDFDLRSLQPDERLENLLQLLSAEDFEKKKEEARKTNRPAELFA
LYPSVDEEDAVEIRPVPECPKEHLGNRILVKVLTLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVDPSSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIAD
CAEPYMVIKESDGGKSKEKVEKLKLQAESFCQRLGKYRMPFAWAPISLASFFNVSTLERE
SNDMETVVGRNSVGERRSLSQSRRPSERSLSLEENGVGSNFKTTTLATSIFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGSLRLEVSSAPDVMNCCLTPEMLPVKPFPENRTRP
HKEVLEFPIREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDPSNAMPV
IFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGA
SGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKG
VFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKITESTLEHELKLSIICL
NSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLRKD
QHGRNCLLASYVHYVFRLPELHRDAPKSGGPAAIPDPRYHTYGRTSAAAVSSKLIQARVM
SSSNPDLAGAHCAADEEVKNIMSSKIADRNCSRMSYYCSGNNDATGSTAAPRPVSKKHFH
EELALQMVVSTGLVRETVFKYAWFFFELLVKSMAQYVHNLDKRDSFRRTRFSDRFKDDIT
TIVNVVTSEIAALLVKPQKESEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQFHT
GNAMQLWRGLSGSGLGTANALNCTLSAKLNTLPTLISMRLEFLRILCSHEHYLNLNLLFM
NTDTAPASPCPSISSQNSSSCSSFQDQKIASMFDLTPEYRQQHFLTGLLFTELAVALDSE
GDGISRVQRKAVSAIHSLLSSHDLDPRCLKPEVKVKIAALYLPLVGIILDALPQLYDFTV
ADARSGRSRASGSYEEQDVANGINQNVALAIAGNHFNLKTSGAMLSSLPYKQYSMLSADT
TRHLMICFLWIMKNADQSLIRRWIADLPSMQLNRILDLLFICVSCFEYKGKQSSDKVSNQ
VLQKSRDVKAKLEEALLRGEGARGEMMRRRTPGNDRFTGLNENLRWRKEQTQWRQANEKM
DKTKAELDQEALISGNLATEANLITLDMQENIIQASSALDCKDSLLGGVLRVLVNSLSCD
QSTTYLTHCFATLRALIAKFGDLLFEEEVEQCADLCQRVLHHCSSSMDVTRSQACATLYL
LMRFSFGATSNFARVKMQVTMALASLVGKAPDFNEEHLRRSLRTILAYSEEDTAMQTTPF
PTQVEELLYNLNSILYDTVKMREFQEDPEMLMDLMYRIAKSYQASPDLRLTWLQNMAEKH
TKKKCFTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSP
DEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTH
DKLQKAFDNIINKDHKRMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKLPEISHRLEGF
YGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRR
FMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYIKTRIQVIQKEEFVLTPIEVAIEDM
KKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNK
LRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELRKNYNKLKDSLRPMIERKIPELYKPI
FRIDSQKRDSFHRSSFRKCETQLSQGS
NT seq 6384 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgccgagcgccgagcgccgcgccttcgcgctcaagatcaacaggtattca
tcatcggaaataagaaagcagtttacactcccacccaacctcggacagtaccaccggcac
agcattagtgcatccggcttccccacccttcagctacctcagctttatgagcccgtggag
ccagtggactttgaaggacttgtgatgacacacttagacagcttggatgcggagctggcc
caggagctgggggacctcaccgatgacgacttgcatgtggcgttcacacccaaggaatgt
aggactttgcagccctctctgccagaggaaggagttgaactggatcctcatgtcagggat
tgtgttcagacttatattcgagagtggctgattgtgaaccggaaaaaccaaggaagctca
gagttttgcagctttaagaaaactggatcacggagagattttcacaagactcttcagaaa
cagacttttgagtcagaaactctggagtgcagtgaaccggccgctcagacaggaccccgt
cagttaaaagtgctgtgtgatgtgtctgagaagggccccctcactacttgtgacttcgac
ctccgcagcctgcagcctgatgagcggctagaaaacctgctgcagcttctcagtgctgag
gactttgagaagaagaaagaggaggcccgcaagaccaatcgaccagctgagctctttgcc
ctgtatccatctgtggacgaggaggatgctgtggaaatacgtccagtgccggaatgtccc
aaggaacatctgggcaacagaatactggtcaaagtgctgactctgaagtttgagattgaa
attgagcctctgtttgccagtattgccctctatgatgttaaagaaagaaaaaagatctcg
gaaaatttccactgtgacctgaactctgaccagttcaaagggttcctgcgagctcacacc
ccctcagtcgacccatcgagtcaggcgaggtctgcagtgttctcagtcacctacccatcc
tcagacatctacctggttgtcaagattgaaaaggtccttcagcagggggagattgcagac
tgtgcagaaccctacatggtcatcaaagaaagtgatggtggaaagagtaaagaaaaggtt
gaaaaactaaaacttcaagctgaatccttctgccaacgtttggggaaataccggatgccc
ttcgcctgggccccaattagcttagcaagcttcttcaacgtctccacccttgaaagggag
agcaatgacatggagactgtggttgggagaaactctgtaggtgagcgaaggagtttgtcc
caatccaggaggccttctgagagatccctctccttggaggaaaatggagttggatccaac
ttcaaaaccaccactttggctactagtatcttcttcaagcaggagggagatcgccttagt
gatgaagatttgttcaagtttttagctgactacaagaggtcttcatccttacagcgaaga
gtcaaatccatcccaggctcacttaggctggaggtatcctcagctcctgatgtgatgaac
tgctgcctgacgcctgagatgctgccagtcaaaccctttcccgagaaccggacacgacca
cacaaggaggtcttggaatttcccataagggaagtgtacgtccctcacactgtgtacaga
aatcttctctacgtctacccacagagactgaactttgctaacaaactagcatctgcccgg
aacattacaataaagatccagtttatgtgtggagaagaccccagcaatgccatgccagtc
atctttgggaagtccagtggacctgaattcctgcaggaagtgtacacagcaattacatac
cataataagtctcccgacttttatgaagaagtaaaaattaagctccctgccaagctcacg
gtgaatcaccacctcctcttcaccttctaccacatcagctgccagcagaagcaaggagcc
tcgggagaaagtcttctggggtattcgtggctgccgattctcttaaatgaacgtcttcaa
accggatcctattgtctcccagttgccttggaaaaactgccacccaactactccatacat
tctgctgagaaagtccctttacagaatccccccatcaagtgggctgagggccataagggg
gtatttaatattgaagtgcaagctgtgtcttccgttcacacccaggacaaccacctggag
aagttcttcaccctttgccactctctggagagccaagtgaccttccctatccgtgttctg
gaccagaagatcacagagagcacactggagcatgagctaaaactcagcatcatctgcctg
aactcctcccgcctggagcccctggtgctcttcctccacctggtgctggacaaactcttc
cagctttctgtgcagcccatggtcattgctggacaaacagcaaacttctcccagtttgcc
tttgagtctgtggtggccattgcaaacagcctgcacaacagcaaggacctgagaaaggac
caacatgggaggaactgcctgctggcctcctacgtgcattatgtcttccggctgcctgag
ctgcacagggatgcacccaagtcaggtggtcctgccgccatccccgacccccgataccac
acctatggacgcacttctgctgctgccgtgagttcaaagctgatacaggcccgtgtgatg
agcagcagcaatccagacctggctggggcacactgtgcagcggacgaggaagttaagaac
atcatgtcttcaaagattgctgatcgaaactgcagccggatgtcttactattgctctggc
aataatgatgctacaggttccactgcagccccaagaccagtcagcaaaaagcattttcac
gaggagctcgccctgcagatggtggtcagcactggactagtgagagaaaccgtcttcaag
tatgcctggttcttcttcgaacttctggtgaaaagcatggcgcagtacgtacataacctg
gataaacgtgacagttttcggaggactcgtttttctgaccgcttcaaagatgacataacg
accattgtgaatgtggtcacctcggagattgcagcccttttagtgaaacctcagaaggaa
agtgaacaggcggagaagatcaacatcagcctggctttcttcttgtatgaccttctctca
ctcatggacaggggcttcgtgttcaacctcatcaagcattattgcaaccagtttcacaca
ggaaatgcgatgcagctgtggagaggtctgtccggttctgggcttgggactgctaatgcg
ctgaactgcacactatcagccaagctcaatacccttccaacactcatttccatgcggctg
gagttcctgagaatcctctgtagccacgaacattacctcaacctgaacctcctcttcatg
aatacagatactgcaccagcctctccctgtccctccatatcctcccagaactcaagctcc
tgctccagtttccaggaccaaaagattgccagtatgttcgacctgaccccggagtaccgg
cagcagcactttctcacggggctcctcttcacagagctggctgtcgccctggattctgaa
ggggatggaatcagcagagtgcagagaaaagctgtgagcgccatccatagcctcctgagt
tctcacgacctggatccacggtgtctcaaaccagaagtcaaggttaagatcgctgccctt
tacttgcccttggtcggcatcattctggacgccttgccacagctctatgactttacagtt
gcagatgctcgaagtggaaggagccgcgccagtggctcttacgaagaacaagatgtggcc
aatggaatcaaccagaatgtggccctggccatagcagggaatcattttaacttgaagaca
agtggagcaatgctgtcttccttgccctataagcaatacagcatgctgagtgcagacacc
acccgccacctcatgatctgcttcctgtggatcatgaaaaatgctgaccagagcctcatt
cggaggtggattgctgacctgccttccatgcagctcaacaggattttagacctgctgttc
atctgtgtctcctgttttgagtacaagggaaagcagagctctgacaaagtcagtaatcaa
gtcctgcagaagtcaagggatgtcaaggccaagctggaagaggccctgctccgtggggaa
ggagcccgtggggagatgatgcgtcgtcgcactccagggaatgaccgatttacaggccta
aatgaaaatctgagatggcggaaagagcagacacagtggcggcaagctaacgagaagatg
gataaaacaaaggcagagttagatcaagaagccttgatcagtggcaatctggcaacagaa
gcaaatttaatcacactggatatgcaggaaaacatcatccaggcaagctccgccctggac
tgtaaagacagcctgctgggaggtgtccttcgagtcctggtgaattctctgagctgtgat
cagagcaccacctacctgactcactgctttgcgactctccgagcactcattgccaagttt
ggagacttgctgttcgaggaggaggtggaacagtgtgctgacctgtgccagagggtgctg
caccactgcagcagcagcatggacgtcacacggagccaggcctgcgccaccctctacctc
ctcatgcgtttcagttttggagccaccagtaattttgcaagagtaaagatgcaggtaacc
atggctctagcatccttggtaggcaaagcaccagacttcaatgaagagcacctgagaagg
tccttgaggacaattctggcctattcagaagaggacacagctatgcaaacaactcctttt
cccacccaggtggaggaacttctttacaatctgaacagcattttatatgacacagtgaaa
atgagggaattccaggaagaccctgagatgctcatggacctcatgtacaggatcgccaag
agctaccaagcgtctcctgacctgcgtctgacctggctccagaacatggcagagaaacac
actaagaagaagtgcttcacagaggctgccatgtgcctggttcacgcagccgccttggtg
gccgagtacctgagcatgctggaggaccacagctacctgcctgtgggcagcgtcagtttt
cagaatatttcctccaatgtgctggaggagtctgcagtctctgacgacaccctgtcacct
gatgaggacggagtgtgctctggtcggtacttcacggagagtggcctggtgggcctcctg
gagcaggctgcagagctcttcagcacgggaggcttgtatgagacagttaatgaagtctac
aagctggtcattcccatcctggaagcacatagagatttccggaagctgacctctactcac
gacaaactgcagaaggccttcgacaacatcatcaacaaggaccataagaggatgtttgga
acttacttccgagttggtttctacggatccaaatttggggatttggatgagcaggaattt
gtgtacaaggagcctgcaattacaaagctcccagagatctcacatagactagagggattt
tatggccagtgttttggtgcagagtttgtggaagtgataaaggactccactcctgtggat
aaaaccaagttggatcctaacaaggcctacatacagatcacttttgtggagccctacttt
gatgagtatgagatgaaagacagggtgacctacttcgagaagaatttcaaccttcgaagg
ttcatgtacaccacccccttcaccctggaggggcggcctcggggagagctgcacgaacag
tatcgcaggaacacagtgctcaccaccatgcatgccttcccctacatcaagaccaggatc
caagtcatccagaaggaggagttcgttttgactccgattgaagttgccattgaagatatg
aagaagaagaccctgcagttagcggtggccactcaccaggagccccctgatgccaagatg
ctgcagatggtactgcaaggctctgtaggagccactgtaaaccagggaccgctggaggta
gcccaagtgttcttggctgagattccagctgacccaaagctctatcgacatcacaacaag
ctgaggttatgcttcaaggagttcataatgcgatgtggcgaggccgtggagaagaacagg
aggctcatcacagcagagcagcgggagtatcagcaggaactcaggaagaactacaacaag
ctgaaggacagtctcaggcccatgattgagcggaaaatcccagagctctacaaacccata
ttcagaattgacagtcaaaagagggactccttccacagatccagtttcaggaaatgtgaa
acccagttgtcacaaggcagctga

DBGET integrated database retrieval system