KEGG   Cricetulus griseus (Chinese hamster): 100757513Help
Entry
100757513         CDS       T02813                                 

Gene name
Rps6kb1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04012  ErbB signaling pathway
cge04066  HIF-1 signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04350  TGF-beta signaling pathway
cge04371  Apelin signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04714  Thermogenesis
cge04910  Insulin signaling pathway
cge04931  Insulin resistance
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05221  Acute myeloid leukemia
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100757513 (Rps6kb1)
   04350 TGF-beta signaling pathway
    100757513 (Rps6kb1)
   04371 Apelin signaling pathway
    100757513 (Rps6kb1)
   04066 HIF-1 signaling pathway
    100757513 (Rps6kb1)
   04151 PI3K-Akt signaling pathway
    100757513 (Rps6kb1)
   04152 AMPK signaling pathway
    100757513 (Rps6kb1)
   04150 mTOR signaling pathway
    100757513 (Rps6kb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100757513 (Rps6kb1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100757513 (Rps6kb1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100757513 (Rps6kb1)
  09149 Aging
   04211 Longevity regulating pathway
    100757513 (Rps6kb1)
   04213 Longevity regulating pathway - multiple species
    100757513 (Rps6kb1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100757513 (Rps6kb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100757513 (Rps6kb1)
   05205 Proteoglycans in cancer
    100757513 (Rps6kb1)
   05231 Choline metabolism in cancer
    100757513 (Rps6kb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100757513 (Rps6kb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100757513 (Rps6kb1)
   05212 Pancreatic cancer
    100757513 (Rps6kb1)
   05225 Hepatocellular carcinoma
    100757513 (Rps6kb1)
   05226 Gastric cancer
    100757513 (Rps6kb1)
   05221 Acute myeloid leukemia
    100757513 (Rps6kb1)
   05224 Breast cancer
    100757513 (Rps6kb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100757513 (Rps6kb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100757513 (Rps6kb1)
   05163 Human cytomegalovirus infection
    100757513 (Rps6kb1)
   05165 Human papillomavirus infection
    100757513 (Rps6kb1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100757513 (Rps6kb1)
   01522 Endocrine resistance
    100757513 (Rps6kb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100757513 (Rps6kb1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100757513 (Rps6kb1)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100757513 (Rps6kb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100757513
NCBI-ProteinID: XP_027282160
Position
7
AA seq 525 aa AA seqDB search
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgcctgacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcaggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagctaatactgggaagatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagagcggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatattcatggaagacacagcttgcttttacttggct
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaacatcatgctcaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcgttaatgtacgacatgctgactggagcacctccattcactggagagaacagaaagaaa
acaattgacaaaatcctcaaatgtaaacttaatttgcctccctacctcacacaagaagct
cgagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggatgctggagaagtccaagcacatccatttttcagacacattaactgggaagaactt
ctagctcggaaggtggagcctccctttaagcctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagccccgatgactcaactctc
agtgaaagtgccaaccaggtctttttgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggt
agcccacgaacgcctgtcagcccggtcaaattctctcctggggatttctggggacgaggt
gcttcagccagcacggcaaatcctcagacacctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgacaatgagcggggaggcatcagccccacttccaatccgacag
ccgaactctgggccatacaaaaaacaagcttttcctatgatctccaaacggccggagcat
ctgcgtatgaatctatga

KEGG   Cricetulus griseus (Chinese hamster): 100760227Help
Entry
100760227         CDS       T02813                                 

Gene name
Rps6kb2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04012  ErbB signaling pathway
cge04066  HIF-1 signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04350  TGF-beta signaling pathway
cge04371  Apelin signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04714  Thermogenesis
cge04910  Insulin signaling pathway
cge04931  Insulin resistance
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05221  Acute myeloid leukemia
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100760227 (Rps6kb2)
   04350 TGF-beta signaling pathway
    100760227 (Rps6kb2)
   04371 Apelin signaling pathway
    100760227 (Rps6kb2)
   04066 HIF-1 signaling pathway
    100760227 (Rps6kb2)
   04151 PI3K-Akt signaling pathway
    100760227 (Rps6kb2)
   04152 AMPK signaling pathway
    100760227 (Rps6kb2)
   04150 mTOR signaling pathway
    100760227 (Rps6kb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100760227 (Rps6kb2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100760227 (Rps6kb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100760227 (Rps6kb2)
  09149 Aging
   04211 Longevity regulating pathway
    100760227 (Rps6kb2)
   04213 Longevity regulating pathway - multiple species
    100760227 (Rps6kb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100760227 (Rps6kb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100760227 (Rps6kb2)
   05205 Proteoglycans in cancer
    100760227 (Rps6kb2)
   05231 Choline metabolism in cancer
    100760227 (Rps6kb2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100760227 (Rps6kb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100760227 (Rps6kb2)
   05212 Pancreatic cancer
    100760227 (Rps6kb2)
   05225 Hepatocellular carcinoma
    100760227 (Rps6kb2)
   05226 Gastric cancer
    100760227 (Rps6kb2)
   05221 Acute myeloid leukemia
    100760227 (Rps6kb2)
   05224 Breast cancer
    100760227 (Rps6kb2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100760227 (Rps6kb2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100760227 (Rps6kb2)
   05163 Human cytomegalovirus infection
    100760227 (Rps6kb2)
   05165 Human papillomavirus infection
    100760227 (Rps6kb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100760227 (Rps6kb2)
   01522 Endocrine resistance
    100760227 (Rps6kb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100760227 (Rps6kb2)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100760227 (Rps6kb2)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100760227 (Rps6kb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 100760227
NCBI-ProteinID: XP_027264511
UniProt: G3I3Z8
Position
3
AA seq 485 aa AA seqDB search
MAAVFDLDLETEEGSEGEGEPEFSPAEVCPLGELRAAGLETVGHYEEVELTENSVNLGPE
RVGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTCGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIMKGKLVLPPYLTPDARDLA
KKFLKRNPIQRIGGGPGDAAEVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPIPGPPEPMEPSLPPLLPPPSSPPPTSTAPLPIRAPSGTKKSKKGR
GRPRR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgtttgatctagacttggaaaccgaggaaggcagcgagggcgagggcgag
ccggagttcagccctgcggaggtgtgtccccttggcgagttgagggctgctggcctggag
acggtgggacactatgaggaggtggagctgacagagaacagcgtgaacctgggccctgaa
cgcgttgggccccactgctttgagcttctgagtgtgctgggcaaggggggctatggcaag
gtgttccaggtgagaaaagtgcaaggcaccaacctgggcaaaatatatgcaatgaaagtc
ttaagaaaggctaagattgtacgcaatgccaaggacacagcacacacccgggctgagcgg
aacattctagaatctgtgaagcatcccttcattgtggaattggcctatgctttccagaca
tgtggcaaactctacctcatcctggagtgcctcagtggcggggagctcttcacacatctt
gagcgagaaggcatcttcttggaagacacagcatgcttctatctggctgagatcacactg
gccctgggccatctccattcccaaggcatcatctaccgggatctcaagcctgagaacatc
atgctcaacagccagggccacatcaaactgacagactttggactctgtaaagagtccatc
catgagggagctgtcacccacaccttctgtggcaccattgaatacatggccccagagatt
ttagtgcgcagtggccacaaccgggcagtggactggtggagcctgggagccctgatgtac
gacatgctcactggatcgccgcccttcaccgcagaaaaccgaaagaaaactatggataaa
atcatgaaagggaagctggtgctgcccccctacctcaccccggatgctcgggaccttgcc
aaaaagtttctgaagcggaatcccattcaacgaattgggggtggcccaggagacgctgct
gaggtgcagaggcaccctttcttccggcacatcaactgggatgacctcttggcccgacgt
gtggaccctcccttcaggccgagtctgcaatcagaagaggacgtgagccagtttgatact
cgcttcacacggcagacgccagtagatagtccagacgacacagccctcagtgagagtgcc
aaccaagccttcctgggcttcacatacgtggcaccttctgtcctggacagcattaaggag
ggcttctctttccagcccaagctgcgttcccccaggcgccttaacagcagtccccgtacc
cccatcagccccctcaagttctctccttttgaggggttccggcccatccctggtccacca
gagcccatggagccatctctacctccactcctgccaccaccatcatcaccaccacccaca
agcactgcccctcttcccatccgtgccccctcagggaccaagaaatccaagaagggccga
gggcgcccaaggcgctaa

DBGET integrated database retrieval system