KEGG   Cricetulus griseus (Chinese hamster): 100757823
Entry
100757823         CDS       T02813                                 

Gene name
Ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100757823 (Ankrd53)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100757823 (Ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Other DBs
NCBI-GeneID: 100757823
NCBI-ProteinID: XP_027284371
Position
8
AA seq 562 aa
ACSEPGVQSFQSCGLRSPFLSVPSVLSQILARFKGDEGAARDTGAGSVRRPSQSSAHRPF
RPRSRAYSLGSFKFRTPSVSGATPQRKTGALGSGEEQSCPETPGSTRQVDHTLSNAASSD
PESSRFSFSGLSGNKVIPIYSELFAASVGNVDWLRFCLNRENQEITVDDKGFTAIHFAAL
KRKLSCLRVLVEEYKFPVDLPTNKGLRPLHLVIHKDKSDLLPCIDYLLKKGAAINSQTCH
GFTPLHLAARNGLLGCVKVLVQRGANVHAQDAMGHKPIDHCKLWNHRDCARFLKDAMWKK
DKKDFAREMEKLKTLKGKLTILEYRYLTECQKEQQILREAHFRTWLQGKLLGRPQSSADP
KQQTGIQPCSLALFKTLRPQISKGLLFYPSVEARLQNLPPPVVLPKLVYKQSTISRPKLW
NLSTNPNRSPTTKIGYPQGIRLGVHPDPYKEHDFCRFLKVTQNSLGGARLRTADNHLVTP
VPQLPFEVMIRVLCPESQPGRMKVPQGLYPVSILNVPQKRHLRDSSSNTLAMNLRETFDE
AFLATLKACRTQMAPPSKGVLS
NT seq 1689 nt   +upstreamnt  +downstreamnt
gcgtgtagtgagcccggggtgcagagtttccagagttgcggtctccggtctccgttcctc
tctgtcccttccgtcctctcacaaatcctggctcggttcaaaggcgatgaaggcgcggcc
agggacacaggggctggtagtgtgcgccgcccctctcagtcttctgcgcaccgccccttt
cggcctcggtctcgtgcatacagcctcggtagtttcaaattccgcacgccctctgtgagc
ggagccactccgcagcgcaagacaggggccttgggttccggagaagagcagtcctgcccc
gagacaccgggcagcacgcggcaggtagaccacaccttgtcgaatgctgcgagcagcgat
cccgagtcctcacggttcagcttttcagggttgtcgggcaacaaagtgattcccatctac
tccgaattgttcgcagcctctgtgggcaacgtagactggcttcggttctgtctaaatcgg
gagaaccaggagatcacagttgatgacaagggcttcacagccatccacttcgcagccctg
aaaagaaagctttcctgccttcgggtcctggtagaggagtacaagtttcctgtggatctg
cctaccaacaaaggcctgaggcccctgcacctcgtcatccataaagacaagtcggacctc
ctcccctgcattgactacctgcttaagaaaggagcagccatcaactctcagacatgccat
ggcttcacacccctgcacctggccgcccgcaatggcctgctgggatgtgtgaaggtcctg
gtacagagaggagccaatgtgcatgcccaagatgccatgggccacaaacccatcgaccac
tgcaaactatggaaccaccgcgactgtgcccggttcttgaaagatgccatgtggaaaaag
gacaagaaggactttgcccgagagatggagaaactgaagaccctgaaggggaagctgacc
attttggagtaccgatacctgactgaatgtcaaaaagaacaacaaattctgagagaggct
catttcagaacatggctccaaggcaagctgctaggccggccccagagctctgctgacccc
aagcaacagactggtatccaaccttgttcattggctctcttcaagactctcagaccccag
atttccaaaggcctcttattttatccttccgtggaggctcgactacaaaacttgccccca
cccgtagtgctacccaagcttgtctacaagcagtccaccatcagtcggcccaaactgtgg
aatcttagcactaaccctaacaggtccccaaccacaaagattggctaccctcagggcata
cgcctgggtgtgcatccagacccttataaggagcatgacttctgtagattcctgaaagtg
actcagaattctcttggaggtgcacggctgcgcacagcagacaatcacttggtgacacct
gtaccccagctgccttttgaggtgatgatccgggtgctgtgcccagagtctcaacccggc
aggatgaaagtgccccagggcttgtatccagttagcatcctcaacgtgccccagaaacgg
catttgagagattcctcttccaacactttggctatgaacctgcgtgagacatttgatgaa
gccttcctggctaccctgaaagcttgccggactcaaatggccccaccctccaagggagtt
ctctcataa

DBGET integrated database retrieval system