KEGG   Cricetulus griseus (Chinese hamster): 100758079
Entry
100758079         CDS       T02813                                 

Gene name
Aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X2
  KO
K15195  AF4/FMR2 family member 3
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cge03021]
    100758079 (Aff3)
Transcription machinery [BR:cge03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100758079 (Aff3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 100758079
NCBI-ProteinID: XP_027242600
Position
1
AA seq 1222 aa
MDSFDLALLQEWDLESLCVYEPDRSALRRKERERRSQEAQQDSGGFNSSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVSQTPVNKVDEHFVAESRSQP
QPSSVCSTSSSTPAAVPVQQSKKGTMSWQKTGHPPSDGQQRAAQQGSLRTLLGDGVGRQQ
TRAKQVCNVEAGLQTQERPPAMAAKHSSSGHCVQNFPPSLSSKPSLVQQKPTAYVRPMDG
QDQAPDESPKLKSSTEAGVHCTSYRGVPANKPESARSKAKLAKFSIPKQAEESRSGESNS
CVEEIIREMTWLPPLSAIQAPGKVEPSKFPFPNKDSQLVSSGHNNPKKADAEPESPDNGT
SNTSMLEDDLKLSSDDEESEQQAAQRTALRALSDSSAVQQTNCRGSVPSSKGSSSGSSSS
SSSSSSDSESSSGSDSETESSSSESEGSKPPHCSSPEAEPASSNKWQLDKWLNKVNPHKP
PILIQNESHGPERNQYYTPVKDEGQDCGKLPEICQASLRDKDLKTACKEEQRPRTANKAP
GSKSVKQKSPPAAAAVAVTSAAPPPAVPSAPTESAPAPTRRSAGKKPTRRTERLSAGDSA
NCHRPEEPVAQDALGASVVGPPEPPKTRPCGNSRTGHRKELRSSVTCEKRRTRGLSRIAP
KSKEFIETESSSSSSSSDSDLESEQEEYVLSKTQTTTTNEQRLKETASSNSSTSRAPVGS
INARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLSQE
PGVLSAPAAKDTDSAPASHALDTTAEKTLPKSKRKRKCDNEDDYREIKKAQGEKESASRL
AASTNNTLSGSHCNMNINSLAIPINKNEKMLRSPTSPLSDACKHKYSSEDLTSSSRPHGN
GVLTSASSNKKPKADSQLQSHAGDLTKAAHNSSENGILHTKSRPQTEPWSPGSSGHRDCK
RQKLIFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPME
SKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAV
KYSKALIDYFKNSSKAAQAPSPWGSSGKSTGSPSPMSPNPSPTSSVGSQGSLSSSSALSP
STIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSS
MEHLVQYSQQGLHWLRSSAHLS
NT seq 3669 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtgtgtctat
gaaccagataggagtgcgttacgaaggaaagaacgagaaagaagaagccaggaagcgcag
caggacagtggcggctttaattccagttactctctcttcagtgaaccctacaagactaac
aagggggatgaactctccaaccgcatccagaatacgttaggaaattacgatgaaatgaaa
gactttttaaccgacagatccaaccagagtcatcttgtcggtgtccccaagccgggtgtt
tctcagactcccgtgaacaaggtagatgaacattttgtggctgagtcaagatcccagccc
cagccttcatctgtctgtagcacttcatcttccacacctgcagctgtccctgtgcagcag
agtaagaagggcaccatgagctggcagaagactgggcacccaccatccgatggccaacag
agagcagcacaacagggctctctcaggaccttgcttggagatggtgttggcagacagcag
acaagggccaagcaagtgtgcaatgtggaggcggggcttcagacccaggagaggccacct
gcaatggcagccaagcacagcagcagtggacactgtgttcagaactttcctccatccttg
tcttcaaaacccagcctggtccagcagaaaccaacagcatacgtgcggccaatggatggc
caagaccaggctcctgatgaatctcctaagcttaagtcatccacagaagctggtgtgcac
tgcacatcctacagaggggtcccagccaacaaaccagagtcagccagatccaaggccaag
ctcgctaagttcagcatccccaagcaagcagaggagagtagatctggagaaagcaacagc
tgtgtagaagaaataatccgggagatgacctggcttcctccactctctgctattcaagct
cccggcaaagtggaaccaagcaagtttccattcccaaataaggactctcaacttgtatcc
tctggacacaataatccaaagaaagctgatgcggagccagagagtccagacaatggcaca
tcgaatacatcgatgctagaagatgaccttaagctaagtagtgatgatgaagagagtgaa
cagcaggcagcccagagaacagctctccgcgccctatctgacagctccgcggtccagcag
accaactgcagaggttccgtgccatccagcaagggcagcagcagcggcagcagcagcagc
agtagcagctcctccagcgactcagaaagcagctccggatccgactcagagactgagagc
agctccagcgagagcgagggcagcaagcctccacactgctccagccccgaggccgaacct
gcatcctctaacaagtggcagctggataaatggctaaacaaagttaatcctcacaagcca
cctattctgatccaaaatgaaagtcatggccccgaaaggaatcaatactacacaccggtg
aaagatgaagggcaggactgcgggaaacttcctgagatctgccaagccagcctgagagac
aaggacctcaagactgcctgcaaggaggagcagcggccgaggaccgcaaacaaggcccct
ggcagcaaaagtgtaaagcaaaagtccccacctgccgccgccgcagtggctgtgacctca
gctgccccgccacctgctgtgcccagcgcacccacggagagcgcacccgcgcccacccgg
aggtcagcaggcaagaagcccacccggcgcaccgagagactctcagctggggacagtgcc
aactgccaccggccagaggagcctgtggcccaagatgcgctgggggcgagtgtggtggga
cccccagagccccccaaaaccagaccctgcggtaacagcaggacaggccaccgcaaggag
ctacgctcctccgtgacctgtgagaaaaggcgcacaagggggctcagcagaattgctcct
aaatccaaggaatttattgagacagaatcctcatcttcgtcttcctcctcggactcagac
ctggagtcagagcaagaggagtacgtcctatccaagactcagaccaccactacaaacgag
cagcgtctgaaggagaccgccagtagcaacagcagcacctcccgggcccctgtggggtcc
atcaatgctaggaccaccagtgacattgccaaggagctagaggaacagttttacacgctg
gttccctttggccggaatgaactgctttctccactaaaggacagtgatgaggtcaggtct
ctctgggtcaaaattgacctgaccctcctgtcccggatcccagaacacctgtcccaagag
cctggggtcttgagcgctcctgcagccaaggacactgatagtgccccagccagccatgca
ttagacacaactgctgaaaagactttgccaaaatccaagaggaaacgcaagtgtgacaat
gaagacgactatagggagataaagaaggcccaaggagagaaggagagtgcttcacgcctg
gctgcctccactaataacaccttgtccgggagccactgcaacatgaacatcaacagcttg
gcaataccaataaacaaaaatgaaaaaatgctccggtcacccacttcaccactctctgac
gcatgcaaacacaaatactccagcgaggacctaacttcttccagccgccctcatggcaat
ggggtattgacttctgcctcttccaacaaaaagccgaaggctgacagccagctgcagtca
cacgctggagacctcacgaaagcagctcacaacagttctgaaaatggcatcctccatacc
aagtcacggccacagactgagccatggtctccaggttccagtggccacagggactgcaag
agacagaaactgatcttcgatgacatgcctcgtagtgcagattattttatgcaagaagct
aaacggatgaagcataaagcagacgcgatggtggagaagtttgggaaagccttgaactat
gccgaagcagccttgtccttcatcgagtgtggaaatgcaatggagcaaggcccaatggaa
tccaagtctccatacaccatgtactcagagacggtggagctcatcaggtacgctatgaga
ctaaaaacccactcaggccccaacgccacaccagaggacaaacagctagctgctctttgt
taccgatgcctggctctcctgtactggcggatgtttcgactgaaaagggaccacgccgta
aagtattcgaaagcacttatcgactatttcaagaattcatcgaaagctgcccaagcccca
tccccatgggggtccagtggcaagagcactggaagcccatcccccatgtctcccaaccct
tctcccaccagctccgtggggtctcagggcagcctctccagctccagtgccctgtccccg
tcaaccatcgtcagcatcccccagcgtattcaccagatggcagccaatcacgtcagcatc
accaacagcatcctccacagctatgactactgggagatggctgacaacctggccaaggaa
aacagagagttcttcaatgacctggatttgctcatgggacctgtcactttgcacagcagc
atggaacacctggtccagtactcccagcaaggtctgcactggcttcggagcagcgcacac
ctgtcctag

DBGET integrated database retrieval system