KEGG   Cricetulus griseus (Chinese hamster): 100758859Help
Entry
100758859         CDS       T02813                                 

Gene name
Adra1a
Definition
(RefSeq) alpha-1A adrenergic receptor
  KO
K04135  adrenergic receptor alpha-1A
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04080  Neuroactive ligand-receptor interaction
cge04152  AMPK signaling pathway
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100758859 (Adra1a)
   04022 cGMP-PKG signaling pathway
    100758859 (Adra1a)
   04152 AMPK signaling pathway
    100758859 (Adra1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100758859 (Adra1a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100758859 (Adra1a)
   04270 Vascular smooth muscle contraction
    100758859 (Adra1a)
  09154 Digestive system
   04970 Salivary secretion
    100758859 (Adra1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100758859 (Adra1a)
G protein-coupled receptors [BR:cge04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100758859 (Adra1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 100758859
NCBI-ProteinID: XP_027246079
Position
1
AA seq 465 aa AA seqDB search
MVLLAENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAGGGGVNSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSQHALGYTLH
PPSQAVEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITRPKDQSACTT
ARVRSKSFLQVCCCVGSSNPSLEENHQVPTIKIHTISLGENGEEV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttctcgctgaaaatgcttcggaaggctccaactgcacccacccaccagcacca
gtgaacatttctaaggctattctgctcggggtgatcttggggggactcatcatcttcggg
gtgctggggaacatcttagtgatcctctcggtggcctgtcatcggcatctgcactcggtg
actcattactacatcgtcaacctggcggtggcagaccttctcctcacctccaccgtgctg
cccttctcggccatctttgagatcctgggctactgggcctttggcagggtcttctgcaac
atctgggctgctgtggacgtcctgtgttgcacagcgtccatcatgggtctctgtatcatc
tccatcgaccgatacatcggtgtgagctaccccctgcgctacccaactattgtcacccag
aggaggggcgtcagggctctgctctgtgtctgggcgctctccctggttatctccatcgga
cccttgttcggctggaggcagccggcgcctgaggatgagaccatctgccagatcaacgag
gagcctggctacgtgctgttctccgcgctgggctctttctacgtgccactggccatcatc
ctggttatgtactgtcgagtctatgtggtggccaagagggaaagtcggggcctcaagtct
ggcctcaagacggacaagtcagactcggagcaagtgacgctccgtatccaccggaaaaac
gtcccggcaggaggtggtggggtgaacagtgccaagaataagactcacttttccgtgagg
ctcctcaagttttcccgagagaagaaagcggccaagactctgggcatcgtggtgggctgc
ttcgtgctctgctggctgcctttcttcctagtgatgcccatcggctccttcttccctgat
ttcaagccctcggaaaccgttttcaaaatagtattttggcttgggtacctaaacagctgc
atcaaccccatcatatacccatgctccagtcaggagttcaagaaagcttttcagaatgtc
ctgagaatccagtgtctccgcagacggcaatctcagcacgccctgggctacaccctgcac
ccgcccagccaggccgtggagggacagcacagagacatggtgcgtatccccgtgggctcc
ggagagactttctataagatctccaagacagacggagtctgtgagtggaagtttttctct
tccatgccccagggatcggccaggattacaaggccgaaggaccaatctgcctgtaccaca
gcccgggtgagaagtaaaagctttttgcaggtctgctgctgtgtggggtcctcgaacccc
agccttgaagaaaatcaccaagttccaaccattaagatccacaccatctccctcggtgaa
aatggggaggaagtctag

DBGET integrated database retrieval system