KEGG   Cricetulus griseus (Chinese hamster): 100759595Help
Entry
100759595         CDS       T02813                                 

Gene name
Ddx18
Definition
(RefSeq) ATP-dependent RNA helicase DDX18 isoform X1
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cge03041]
    100759595 (Ddx18)
   03009 Ribosome biogenesis [BR:cge03009]
    100759595 (Ddx18)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100759595 (Ddx18)
Spliceosome [BR:cge03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    100759595 (Ddx18)
Ribosome biogenesis [BR:cge03009]
 Eukaryotic type
  90S particles
   Helicases
    100759595 (Ddx18)
  Pre-60S particles
    100759595 (Ddx18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII DivIC
Motif
Other DBs
NCBI-GeneID: 100759595
NCBI-ProteinID: XP_027273582
Position
5
AA seq 657 aa AA seqDB search
MSQLQMKILRKKIEKRNVKLRQRNQKLQAEAWDSSESQPQDGAVLKEGKVKKAKKHSVSV
DSADAQSGGMPEETVGNSKVKKLPQKPTTLTNGETAATPSPDSEPKKKKKKKRKMGNDAG
PDTKKSKTEENAGAHEEAESSVEKPNDREVPSLPLGLTGAFEDTSFASLSNLVNENTLKA
IEEMGFKRMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPVIELIVKLKFMPRNGTG
VLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLINGINIIVATPGRLL
DHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPVRRQTMLFSATQTRKVED
LARISLKKEPLYVGVDDDKEVATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKVMVFFS
SCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGILLCTDVAARGLDIPE
VDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRYLKQSKVPLNQFDF
SWSKVSDIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSF
GFKVPPFVDLNVSSHDGKLKKRGGGGGFGYQKSKKAEKSKIFKHISKKSADRRQFSH
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaattacagatgaaaatcctgcgcaaaaagatcgagaagcggaacgtcaagctg
cggcagcggaaccagaagctgcaagcagaagcatgggattcaagcgaatcacaacctcaa
gatggagctgtgcttaaagaaggaaaagttaagaaagccaaaaagcattctgtgagtgtg
gactcggcagatgcacagagtggaggcatgcctgaagagacagtggggaactcaaaagtt
aaaaaattacctcaaaaacctaccactttaacaaatggtgaaacagcagcaacgccatct
cctgattcagaaccaaaaaagaaaaagaagaaaaagaggaaaatgggaaatgatgcaggg
cctgacaccaaaaaatcgaaaacggaagaaaatgctggggctcacgaggaagcagaaagc
agtgtggagaagccgaacgacagggaggtgcccagcctgcccctaggactgacaggcgct
tttgaggacacttcatttgcttccttgtctaaccttgtcaatgaaaacactctgaaagct
atagaagaaatgggcttcaagcgcatgactgagatccaacataaaagtatcaggccactt
ctggaaggcagggatcttctggcagctgcgaaaacaggcagtggcaaaacgcttgctttc
ctcatccccgtgatcgagctcattgtcaagttgaagttcatgcctaggaatggaacagga
gtcctgattctctctcctaccagagaactggccatgcagactttcggcgttcttaaggaa
ctgatgacacaccatgttcacacgtatggactgatcatgggtggcagtaacaggtctgct
gaagcacagaagctcatcaatggcatcaacatcatcgtggccaccccaggccggctcctg
gaccacatgcagaatactccagggttcatgtacaagaacctccagtgtctggttattgat
gaggctgatcgtatcttggatgttgggtttgaagaagaattaaagcaaattattaaactt
ttgccagtccgcaggcaaaccatgctcttttctgccacacaaactcgaaaagttgaagac
ctggcaagaatttctctgaaaaaagagccattgtatgtgggtgtagatgacgataaagag
gttgccactgtggatgggcttgagcagggctatgtcgtgtgtccctctgagaagaggttc
cttctgctcttcacattccttaagaagaaccggaagaagaaagtgatggtcttcttttca
tcgtgtatgtctgtgaagtaccactatgagctactgaactacattgacctgcctgtcttg
gccatccatgggaagcaaaagcaaaataagcgaacaaccacgttcttccaattctgcaat
gcagattcggggatactgctgtgcacagatgtggcagccagagggctggacatccctgaa
gtggactggattgttcagtatgaccctcccgatgaccccaaggaatatattcatcgtgtg
ggtagaacagccagaggtctgaatggaagagggcatgccctgctcatcctgcgtcctgaa
gagttgggtttccttcgttacttgaagcaatccaaggttccattgaatcaatttgacttt
tcctggtctaaagtttctgatattcagtctcagctggaaaagctgatcgaaaagaactat
tttctccataagtccgcacaggaagcatacaagtcctacatacgagcatatgactcccac
tcgctcaagcagatcttcaatgtcaacaacttaaatttgcctcaggttgccctgtctttt
ggttttaaggtccctccttttgttgatctgaatgtgagcagccatgatggcaagcttaaa
aagagaggaggtggcggtggattcggctaccagaaatcaaagaaagcggagaagtccaag
atctttaaacacatcagcaagaagtcagcagaccgcaggcagttctctcactga

DBGET integrated database retrieval system