KEGG   Cricetulus griseus (Chinese hamster): 100760125Help
Entry
100760125         CDS       T02813                                 

Gene name
Cwc27
Definition
(RefSeq) spliceosome-associated protein CWC27 homolog
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cge03041]
    100760125 (Cwc27)
   03110 Chaperones and folding catalysts [BR:cge03110]
    100760125 (Cwc27)
Enzymes [BR:cge01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100760125 (Cwc27)
Spliceosome [BR:cge03041]
 Complex C
  Other components
   PPlases
    100760125 (Cwc27)
Chaperones and folding catalysts [BR:cge03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100760125 (Cwc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 100760125
NCBI-ProteinID: XP_027257332
UniProt: G3HXI0
Position
2
AA seq 471 aa AA seqDB search
MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPG
FIVQGGDPTGTGTGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRA
DELNNKHTIFGKVTGDTVYNMLRLTEVDIDDEERPRNPHRVKSCEVLFNPFDDIIPREIK
RPKKEKPDEEIKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGRSKSSHDLLKDDP
HLSSVPAVESEKDDATGDLEDDGEDENADPDECIDDDEKNLMRERIAKRLKKDTSANVKS
AGEGEGEKKPASRSEELRKEARQLKRELLAAKQKKETTTKAEKGNEEEEAAPDGAVAEYR
REKQKYEALRKQQPKKGTSREDQTLALLSQFKSKLTQAITETPESTVPEAEVEDDEGWMS
HVLQFEDKTRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLLREKKERR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatctacatccaggagccgcccacgaatgggaaggttttattgaaaactacg
gctggagatattgacatagagttgtggtcaaaagaagctccaaaggcatgcagaaatttc
attcaactttgtttggaagcatactatgacaacaccatttttcacagagttgtgcctggt
ttcatagtccaaggtggagaccccacaggcaccgggactggtggagagtccatctatgga
gcaccgttcaaggatgaatttcactccaggttgcgttttaataggagaggactggttgcc
atggcaaatgctggtccacatgataatggcagccagtttttctttaccctgggtcgagca
gatgaacttaacaataagcacaccatctttggaaaggtcacaggggatacagtctacaac
atgctacgcctgacagaagtagacattgatgatgaagaaagaccccgcaatccacataga
gtcaaaagctgtgaggttctgtttaatccttttgatgacatcattccaagagaaattaaa
aggcccaaaaaagagaaaccggatgaagaaatcaagaaattgaagcctaaaggcacaaaa
aactttagtttactttcttttggggaagaagctgaggaggaagaggaggaagtgaaccga
gtcagtcagagcatgaagggaagaagtaaaagcagccatgacctgcttaaggacgatcca
cacctaagttccgtgccagctgtggaaagtgaaaaggatgatgcaacaggagatttagaa
gatgatggagaagatgagaatgcagatcctgatgaatgcattgatgatgatgaaaagaac
ctgatgagagaaagaattgcaaaaaggttaaaaaaagacacaagtgcaaatgtgaaatca
gctggagagggagaaggagaaaaaaagccggccagccgcagtgaagagctcagaaaagaa
gcaaggcaactgaagcgggaacttttagctgcaaaacagaaaaaggagactacaacaaaa
gcagagaaaggaaatgaagaggaagaggctgccccagatggcgctgtggcagaatacagg
cgagaaaagcaaaagtatgaagctttgaggaagcaacagcctaagaagggaacgtctcgg
gaagatcagacccttgcactgctgagccagtttaaatcgaagctcactcaagcaattact
gaaacacctgagagcactgttcctgaagcagaggtggaagatgatgaaggatggatgtca
catgtgctccagtttgaagacaaaaccaggaaagtgaaagatgcaagcatgcaggactca
gacacatttgagatctacgatcctcggaatccggtgaacaaaagaagaagggaagagagc
aagaagctgttgagagagaagaaagaaagaaggtga

DBGET integrated database retrieval system