KEGG   Cricetulus griseus (Chinese hamster): 100760248Help
Entry
100760248         CDS       T02813                                 

Definition
(RefSeq) cytochrome P450 2B1-like isoform X2
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00140  Steroid hormone biosynthesis
cge00590  Arachidonic acid metabolism
cge00830  Retinol metabolism
cge01100  Metabolic pathways
cge05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100760248
   00590 Arachidonic acid metabolism
    100760248
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100760248
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100760248
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cge00199]
    100760248
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100760248
Cytochrome P450 [BR:cge00199]
 Cytochrome P450, animal type
  CYP2 family
   100760248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100760248
NCBI-ProteinID: XP_027289960
Position
Unknown
AA seq 437 aa AA seqDB search
MFKFREKYGDVFTLYLGSKPVVMLYGTEAIREALVDQAEAFSGRITIAVLKPIFMDYGVI
FANGERWKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPKFLFQCI
TANIICSIVFGERFDYKDGQFLRLLDLFYQTFSIISSLSTQMFEFFSGFLKYFPGSHVQV
CKNLQEILDYIGHSVEKHRLNLDPSNPRDFIDTYLLRMEKEKSIPHTEFHHKNLVITVLS
LFFAGTETSSTTLRYGFLLMLKYPHVTEKVQKEIDQVIGSNRLPTLDDRTKMPYTEAVIH
EIQRFSDLIPIGVPHKVTKDTLFRGYLLPKDTEVYPILSSALHDPQHFEQPDTFNPDHFL
DANGALKKNEAFMPFSIGKRICLGEGIARNELFLFFTTLLQNFSLSSLMAPKDIDLSPKE
NGFGRVPPDYQICFLAR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtttcgagaaaaatatggagatgtgtttaccttgtacctgggatcaaagccg
gtggtcatgttgtatgggacagaggccataagagaggctctggtggaccaagcggaggct
ttctctggccggataacaattgctgtgcttaaacctattttcatggactatggtgtgatc
tttgccaatggggaacgctggaaggcccttcggcgattctctctggccaccatgagagac
tttgggatgggaaagcggagtgtagaggagaggattcaggaggaggcccaatgcctggta
gaggagctacggaaatctcagggagcacctctggatcccaagttcctctttcagtgcatc
acagccaatatcatctgttccattgtctttggagagcgctttgactacaaagatggccag
ttcctgcgcctgctggacctgttctatcagactttctcaatcattagctcactatccact
cagatgtttgagttcttttctggcttcctgaagtactttcctggttcccatgtacaagtt
tgcaaaaacctgcaggaaatccttgactacattggacacagtgtggagaagcacaggcta
aacttggaccccagtaatccaagagacttcattgatacctaccttctacgcatggagaag
gagaagtccatcccacacacggaattccatcacaagaaccttgtgatcaccgtgctgtct
ctcttctttgctggcaccgagaccagcagcaccacgctccgctatggcttcctgctcatg
ctcaaatacccccatgtcacagaaaaagtccagaaggagattgatcaggtgatcggttca
aaccgcctaccaacccttgacgaccgcaccaaaatgccatacactgaggctgtcatccat
gaaattcagagattttcagaccttatcccaattggtgtgccacacaaagtcaccaaagac
actttgttccgcgggtacctgctccccaaggacactgaagtgtaccccatcctgagctca
gctctccatgacccacagcactttgaacaaccagataccttcaatcctgaccacttcctg
gatgccaatggggcactgaagaaaaatgaagcttttatgcccttctctataggaaagcgc
atttgtcttggagaaggcatcgcccgcaacgaattgttccttttcttcaccaccctcctc
cagaacttctctctgtccagtctcatggctcccaaggacattgacctcagtcccaaggag
aatggctttggaagagtgcccccagactaccagatttgcttcttggcccgataa

DBGET integrated database retrieval system