KEGG   Cricetulus griseus (Chinese hamster): 100760602
Entry
100760602         CDS       T02813                                 

Gene name
Il12a
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04060  Cytokine-cytokine receptor interaction
cge04620  Toll-like receptor signaling pathway
cge04622  RIG-I-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  JAK-STAT signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04940  Type I diabetes mellitus
cge05133  Pertussis
cge05134  Legionellosis
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05143  African trypanosomiasis
cge05144  Malaria
cge05145  Toxoplasmosis
cge05146  Amoebiasis
cge05152  Tuberculosis
cge05162  Measles
cge05164  Influenza A
cge05168  Herpes simplex virus 1 infection
cge05200  Pathways in cancer
cge05321  Inflammatory bowel disease
cge05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100760602 (Il12a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100760602 (Il12a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100760602 (Il12a)
   04622 RIG-I-like receptor signaling pathway
    100760602 (Il12a)
   04625 C-type lectin receptor signaling pathway
    100760602 (Il12a)
   04658 Th1 and Th2 cell differentiation
    100760602 (Il12a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100760602 (Il12a)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100760602 (Il12a)
   05330 Allograft rejection
    100760602 (Il12a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100760602 (Il12a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100760602 (Il12a)
   05134 Legionellosis
    100760602 (Il12a)
   05152 Tuberculosis
    100760602 (Il12a)
  09172 Infectious disease: viral
   05162 Measles
    100760602 (Il12a)
   05164 Influenza A
    100760602 (Il12a)
   05168 Herpes simplex virus 1 infection
    100760602 (Il12a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100760602 (Il12a)
   05144 Malaria
    100760602 (Il12a)
   05145 Toxoplasmosis
    100760602 (Il12a)
   05140 Leishmaniasis
    100760602 (Il12a)
   05142 Chagas disease
    100760602 (Il12a)
   05143 African trypanosomiasis
    100760602 (Il12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100760602 (Il12a)
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100760602 (Il12a)
Cytokines and growth factors [BR:cge04052]
 Cytokines
  Interleukins
   100760602 (Il12a)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Haparin
  Cytokines
   100760602 (Il12a)
SSDB
Motif
Pfam: IL12 DUF5634_N
Other DBs
NCBI-GeneID: 100760602
NCBI-ProteinID: XP_027247439
Position
1
AA seq 215 aa
MCPSRCLLFLTILVLLIHLSLARATPVSRPAQCLDRSQNLLRTTNHMLDKARQILKHYPC
TAEDIDHEDITADKTSTLKACLPPELVKNESCLASTETASLTRGSCLPPRRTSLMMTLCL
GSIYEDLKVYRTEFKAINAELLDHNQKQVILDENMLTAIDELMQALNLNGETLPQRPSQE
EGDPYKVKMKLCILLQAFSIRAVTINRVMSYLNSS
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtgtccatcgcgctgcctcctctttttgaccatccttgtcctcctaatccacctcagt
ctggccagggccacaccagtctccagacctgcccagtgtcttgaccgctcccaaaacctg
ctgaggaccaccaaccatatgctggataaggccagacaaattctgaaacattatccctgc
actgctgaagacattgatcatgaagacatcacagcagacaaaaccagcacactgaaggcc
tgtttaccaccggaactagtcaagaatgaaagttgtctggcttctacagagactgcttcc
ctaacaagagggagctgcctgccccccagaaggacttctttgatgatgaccctgtgcctt
ggtagcatctatgaggacttgaaggtgtaccggacagagttcaaggccatcaatgcagag
cttttggatcataatcagaagcaggtgattctggatgagaacatgctgacggccattgat
gagctgatgcaggctctgaatctcaatggtgagactctgccccagagaccttcccaggaa
gaaggtgatccctacaaagtgaaaatgaagctctgcattctactacaggctttcagcatc
cgtgctgtgactatcaacagagtgatgagctatctgaattcctcctga

DBGET integrated database retrieval system