KEGG   Cricetulus griseus (Chinese hamster): 100760676Help
Entry
100760676         CDS       T02813                                 

Gene name
Plk1
Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04114  Oocyte meiosis
cge04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100760676 (Plk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100760676 (Plk1)
   04114 Oocyte meiosis
    100760676 (Plk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100760676 (Plk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100760676 (Plk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100760676 (Plk1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     100760676 (Plk1)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   100760676 (Plk1)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100760676 (Plk1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100760676 (Plk1)
  Sister chromatid separation proteins
   Polo kinases
    100760676 (Plk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 100760676
NCBI-ProteinID: XP_027266076
UniProt: G3IN30
Position
3
AA seq 602 aa AA seqDB search
MNAAAKKLARAPADLGKAGVPGDAATGAPVTAPLSKEIPEVLVDPRSRRQYVRGRFLGKG
GFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHGFFED
SDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLGNL
FLNEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMY
TLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELLND
EFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSSRKPLTVLNKGVENPLPDRPREKEEPV
VRETNEAIECHLSDLLQQLTSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYG
LGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYF
RNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGTVQINFFQDHTKLI
LCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKA
SS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcggccaaaaagctggctcgagcaccagccgatctcgggaaagctggggtt
cctggagatgcagctaccggtgccccagtgaccgccccgctgtcgaaagagattcctgag
gtcttagtggacccacgcagccggcgccagtatgtgcggggccgctttctgggtaaagga
ggatttgccaaatgcttcgagatctcggatgcagacacaaaggaggtgttcgcaggcaag
atcgtgccgaagtctttacttctcaagccccaccaaaaggaaaagatgtctatggagatt
tctatccaccgcagcctcgcacaccaacacgtcgtaggcttccacggcttttttgaggac
agcgactttgtgtttgtggttttggagctctgtcgcaggaggtctctcctggaactgcac
aagaggaggaaagcgctgaccgagcccgaggcacgctactatctacgtcagatagtcctg
ggctgccagtatctgcaccgaaatcaggtcattcacagggacctcaagctaggcaacctc
ttcctgaacgaggatctggaggtgaaaataggggactttgggctggcaaccaaagtggaa
tatgaaggtgaacgaaagaagaccttatgtggcactcctaactacatagctcccgaggtg
ctgagcaagaagggacacagttttgaggtggatgtgtggtccattgggtgtatcatgtac
accttgctagtgggcaagccaccttttgagacctcatgcctaaaagagacctacctccgg
atcaagaaaaatgaatacagcattcccaagcacatcaatcccgtggccgcctcccttatc
cagaagatgcttcagacagaccccactgcccgccccaccattcacgagttgctcaatgac
gagttcttcacttctggttatatccctgcccgtctccccatcacctgcctcaccatccca
ccaaggttttcaattgctcccagcagcctggaccccagcagcaggaagcctctcacagtt
ctcaataaaggtgtggagaacccattgcctgaccgtccccgggaaaaggaggaaccagtg
gttcgggagacgaatgaagccattgagtgccaccttagtgacttgctgcagcagttgacc
agtgtcaatgcctctaagccctcagagcgagggctggtgcggcaagaggaggctgaggat
cctgcatgtatccctatcttctgggtcagcaagtgggtggactattcggacaagtatgga
cttgggtatcagctgtgtgacaacagtgtgggggtgctcttcaatgactcaacacgcctc
atcctctacaatgacggtgacagcctacagtacatagaacgtgatggcacagagtcttac
ctcaccgtgagctcccaccctaactcgttgatgaagaagatcacgctcctgaagtatttc
cgaaattacatgagtgaacacttgctgaaggcaggggccaacatcacacctcgggaaggt
gatgaactggcccggctgccttacctgcgaacgtggttccgcacacgcagtgccatcatc
ctgcacctcagcaatgggactgtacaaattaacttctttcaggaccacacaaaacttatc
ctgtgccctctgatggcagcagtgacctatatcgatgagaagagggacttccgcacatac
cgcctaagtcttctggaggaatatggttgctgcaaggaactggctagccggctacgctat
gcccgtaccatggtagacaagctgctaagctcgcgctctgccagcaaccgcctgaaggcc
tcctcttag

DBGET integrated database retrieval system