KEGG   Cricetulus griseus (Chinese hamster): 100761333Help
Entry
100761333         CDS       T02813                                 

Gene name
Ndufs3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00190  Oxidative phosphorylation
cge01100  Metabolic pathways
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge05010  Alzheimer disease
cge05012  Parkinson disease
cge05016  Huntington disease
Module
cge_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100761333 (Ndufs3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100761333 (Ndufs3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100761333 (Ndufs3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100761333 (Ndufs3)
   05012 Parkinson disease
    100761333 (Ndufs3)
   05016 Huntington disease
    100761333 (Ndufs3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100761333 (Ndufs3)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     100761333 (Ndufs3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     100761333 (Ndufs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 100761333
NCBI-ProteinID: XP_027278405
Position
6
AA seq 263 aa AA seqDB search
MAAAAARVWWRGLVGAASVARGTGRPSALLQRVRRESAAADTRPTVRPKNDVTHKQLSAF
GEYVAEILPKYVQQVQVTCFNELEICIHPDGVIPVLTFLKDHTNAQFKSLADMTAVDVPT
RQNRFEIVYNLLSLRFNSRIRVKTYADELTPIESVVSVHKAANWYEREVWDMFGVFFVNH
PDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEA
FPAYRQPPESLKLEAGDKKPEAK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgcagccagagtctggtggcgtgggctcgtgggggctgcttccgtagcc
agggggactgggcgaccctcagcgctgttgcaacgggtgaggagggagagcgcggcggct
gacacgcgccccactgtcagaccaaagaatgatgtgacccacaagcagctctcagcattt
ggagagtatgtggctgaaatcctacccaagtatgtccaacaagttcaggtgacctgcttt
aatgagttagaaatctgtatccatcctgatggagtcatccccgtgctgacttttctcaag
gatcacaccaatgcacaattcaaatccttggctgacatgacagcagtagatgtcccaact
cggcagaaccgttttgagattgtctacaacctgctgtccctgcgcttcaactctcggatc
cgtgtgaagacctatgcagatgagctgacacccattgagtctgtggtctctgtgcacaag
gcggccaactggtatgagagggaggtctgggacatgtttggagttttctttgttaaccac
cctgatctaagaaggatcctgacagactatggcttcgagggacatcctttccggaaagac
tttcccctctctggctatgttgagctacgttacgacgatgaggtgaagcgggtagtggct
gaaccggtggagttggcacaagagttccgcaagtttgacctgaacagtccctgggaggct
ttccctgcctatcgtcagccccctgagagtctcaagcttgaagctggagacaagaagcct
gaagccaagtag

DBGET integrated database retrieval system