KEGG   Cricetulus griseus (Chinese hamster): 100761966Help
Entry
100761966         CDS       T02813                                 

Gene name
Slc29a2
Definition
(RefSeq) solute carrier family 29 member 2
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cge02000]
    100761966 (Slc29a2)
Transporters [BR:cge02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   100761966 (Slc29a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 100761966
NCBI-ProteinID: XP_003509475
UniProt: G3I2H4
Position
3
AA seq 458 aa AA seqDB search
MAREDSPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGANGTAETLSTNHTGS
TDTYNFNNWVTLLSQLPLLLFTLLNSFLYQCIPEVVRILGSLLAILLLFVLTAVLVKVDL
SPGLFFSITMASVWFINSFCAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLMS
MASGVDAQTSALGYFITPCVGILLSIVCYLSLPHLEFAQYYLAKKLSQAPAQELETKAEL
LQADEKNGIPISPQKAGPALDLDLEKEPESELELDGPQKSEKPSVFVVFRKIWLTALCLV
LVFTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSYFLWPDEDS
RLLPLLVCLRFLFVPLFMLCHVPKRVRLPTIFWQDAYFITFMLLFAISNGYLVSLTMCLA
PRQVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgagaagactcccctcgggacagctaccaccttgtcgggatcagcttcttcatc
ctgggattgggcaccctcctcccctggaacttcttcattaccgctatcccgtacttccag
gcacggttggcaggggccaatggcacagctgagactctgagcaccaaccacactggttcc
acagacacttacaacttcaacaactgggtgacactgctgtcccagctgcccctactgctc
ttcacactcctcaactccttcctgtatcagtgcattcctgaggtagtacgtattctgggc
agcctgctggccatactactgctgtttgtcctgactgcagtattggtgaaggtggacttg
agccccgggctgttcttttccatcaccatggcatctgtctggttcattaattccttctgt
gcagtgcttcaaggcagcctctttgggcagctgggtaccatgccttctacctacagcacc
ctcttcctcagtggccagggcctggctgggatcttcgctgcccttgctatgctcatgtcc
atggccagtggtgtagatgcccagacctctgccctcgggtacttcatcacaccctgtgta
ggcatcctcctctccatcgtgtgttaccttagcctgccccatctggagtttgctcaatac
tacctggccaagaagctgtcccaggccccagctcaggagctagagaccaaagctgagctc
ctccaagctgatgagaagaatgggattcccattagcccccagaaggcaggcccagctctg
gatcttgaccttgagaaggagccggagtcagagctggaactggacgggccacagaagtca
gaaaaaccttcagtctttgttgttttccggaagatctggctgacggcgctgtgccttgtg
ttggtcttcacagtcacactgtcggtctttcctgccatcacagccatggtgaccagctcc
accagccctgggaagtggagccagtttttcaaccccatctgctgcttcctgctcttcaac
atcatggattggctgggccggagtctgacttcctacttcctgtggccagatgaggacagc
cggctgctgcccctgctggtgtgcctgcgtttcctgtttgtgcccctcttcatgctctgt
cacgtgcccaagcgagtccggctgcccaccatcttctggcaggacgcctacttcatcaca
tttatgctgctcttcgccatttccaacggctacttggtgtctctcaccatgtgtctggca
cccaggcaggtgctaccacatgagagggaggtggctggagccctcatgaccttcttcctg
gccctgggactctcctgcggagcctctctttccttcctctttaaggcattgctctga

DBGET integrated database retrieval system