KEGG   Cricetulus griseus (Chinese hamster): 100763298Help
Entry
100763298         CDS       T02813                                 

Gene name
Sirt1
Definition
(RefSeq) LOW QUALITY PROTEIN: NAD-dependent protein deacetylase sirtuin-1 isoform X2
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00760  Nicotinate and nicotinamide metabolism
cge01100  Metabolic pathways
cge04068  FoxO signaling pathway
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04922  Glucagon signaling pathway
cge05031  Amphetamine addiction
cge05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100763298 (Sirt1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100763298 (Sirt1)
   04152 AMPK signaling pathway
    100763298 (Sirt1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100763298 (Sirt1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100763298 (Sirt1)
  09149 Aging
   04211 Longevity regulating pathway
    100763298 (Sirt1)
   04213 Longevity regulating pathway - multiple species
    100763298 (Sirt1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100763298 (Sirt1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100763298 (Sirt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100763298 (Sirt1)
   03029 Mitochondrial biogenesis [BR:cge03029]
    100763298 (Sirt1)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     100763298 (Sirt1)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     100763298 (Sirt1)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100763298 (Sirt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 TPP_enzyme_M DUF592 Pox_A11
Motif
Other DBs
NCBI-GeneID: 100763298
NCBI-ProteinID: XP_027250839
UniProt: G3HAB1
Position
1
AA seq 746 aa AA seqDB search
MADEAALALQAGGSPSAAAAMEAASQPADEPLRXRARRDGPGLGRSPGESSPAAVAVAAA
AAAAAGCEAASAAAPAAALWREAVGAAAAGAEQEXPGDRRGRDGNNGSGLRREPRAADDF
DDDEGEEDDEAEAVAAAAAIGYRDNLLFTDEIITNGFHSCESDEDDRTSHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCETVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELVHLSELPPTPLHISEDSSS
PERTVPQDSASMIATCVDQATENRVDLEVSESEGCVEEKSQEAQTCRSVESINVENPDLK
AVGSSTGEKNERTSVAEAVRKCWPNRLAKEQISKRLDGNQYLFVPPNRYIFHGAEVYSDS
EDDILSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDDTDRPEGTGGSGLGVDG
GEQELVHEATAMRQEATDVNYPSDKS
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggcggcgctcgcccttcaggccggcggctccccttccgcagcggccgcc
atggaggccgcgtcgcagcccgccgacgagccgctccgcnnaagagcgcgcagagacggg
cctggcctcgggcgcagcccgggcgagtcgagcccggcggccgtggcggtggcggcggcg
gcggcggcggcggcggggtgtgaggcggcgagcgccgcggccccggcggcggcgctgtgg
cgggaggcggtaggggcggcggcggcgggcgcggagcaagagnngcccggcgaccgccgc
ggccgggacggaaacaatgggtcgggcctgcggcgggagccgagggctgccgacgacttc
gacgacgacgagggcgaggaggacgacgaggcggaggcggtggcggcggcggcagcgatc
ggctaccgagacaacctcctgttcactgatgaaatcatcactaatggctttcattcctgt
gaaagtgatgaagacgatagaacttcgcatgcaagctctagtgactggactccacggccg
aggataggtccatatacttttgttcagcagcatctcatgattggcacggatcctcgaaca
attcttaaagatttactacccgaaacaatccctccacctgagttggatgatatgacactg
tggcagattgttattaatatcctttcagaaccaccaaaacggaaaaaaagaaaagatatt
aatacgattgaagatgccgtgaagttacttcaagaatgcaaaaagataatagttttaact
ggagctggggtttctgttagctgtgggatacctgatttcagatcaagagatggtatttat
gctcgccttgctgtggacttcccagatctcccagatcctcaagccatgtttgatattgag
tattttagaaaagatccaagaccattcttcaagtttgcaaaggaaatatatcctggacag
ttccagccatctctgtgtcataaattcatagctttgtcagataaggaagggaaactactt
cgaaactatacccaaaatatagataccttggagcaggttgcaggaatccaaaggatcatt
caatgtcatggttcatttgcaacagcatcttgtttgatttgtaaatacaaagttgattgt
gaaactgttcgaggagatatttttaaccaggtagttcctcggtgtcctagatgcccagct
gatgagccacttgctatcatgaagccagagattgttttctttggtgaaaatttaccagaa
cagtttcatagagccatgaagtatgacaaagatgaagttgacctcctcattgttattggg
tcttctctgaaagtaagaccagtagcactaattccaagttccataccccatgaagtgcct
caaatattaataaatagggaacctttgcctcatctgcattttgatgtagagcttcttgga
gactgtgatgtcataattaatgagttgtgtcataggttaggtggtgaatatgccaaactt
tgttgtaaccctgtaaagctgtcagaaatcactgaaaaaccaccacgaacacaaaaggaa
ttggttcatttatcagagttgccaccaacacctcttcatatttcggaagattcgagttca
cctgaaagaactgtaccacaagattctgcttccatgattgctacatgtgtagaccaagca
acagagaacagagttgatttagaagtatctgaatcagaaggctgtgtggaagaaaagtca
caagaagcacagacttgtaggagtgttgagagcattaatgtggaaaatccagatctcaag
gctgttggttccagtactggagagaaaaatgaaagaacttcagttgcagaagcagtgaga
aagtgctggcccaatagacttgcaaaggagcagattagcaagcggcttgatggtaatcaa
tacttgtttgtaccaccaaaccgttacatattccatggcgcggaggtatactcagactct
gaagatgacatcttatcctctagttcctgtggcagtaacagtgacagtggcacatgccag
agtccaagtttagaagaacccatggaggatgaaagtgaaattgaagagttctacaatggc
ttggaagatgatactgatagacctgaaggtactggaggatctggacttggagtggatgga
ggggagcaggagttagttcatgaagccacagccatgagacaggaagcgacagatgtaaac
tatccatcagacaaatcataa

DBGET integrated database retrieval system