KEGG   Cricetulus griseus (Chinese hamster): 100764780
Entry
100764780         CDS       T02813                                 

Gene name
Tnf
Definition
(RefSeq) tumor necrosis factor isoform X1
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01523  Antifolate resistance
cge04010  MAPK signaling pathway
cge04060  Cytokine-cytokine receptor interaction
cge04061  Viral protein interaction with cytokine and cytokine receptor
cge04064  NF-kappa B signaling pathway
cge04071  Sphingolipid signaling pathway
cge04150  mTOR signaling pathway
cge04210  Apoptosis
cge04217  Necroptosis
cge04350  TGF-beta signaling pathway
cge04380  Osteoclast differentiation
cge04612  Antigen processing and presentation
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04622  RIG-I-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04640  Hematopoietic cell lineage
cge04650  Natural killer cell mediated cytotoxicity
cge04657  IL-17 signaling pathway
cge04660  T cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04668  TNF signaling pathway
cge04920  Adipocytokine signaling pathway
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04940  Type I diabetes mellitus
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05132  Salmonella infection
cge05133  Pertussis
cge05134  Legionellosis
cge05135  Yersinia infection
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05143  African trypanosomiasis
cge05144  Malaria
cge05145  Toxoplasmosis
cge05146  Amoebiasis
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05205  Proteoglycans in cancer
cge05310  Asthma
cge05321  Inflammatory bowel disease
cge05322  Systemic lupus erythematosus
cge05323  Rheumatoid arthritis
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05410  Hypertrophic cardiomyopathy
cge05414  Dilated cardiomyopathy
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100764780 (Tnf)
   04350 TGF-beta signaling pathway
    100764780 (Tnf)
   04064 NF-kappa B signaling pathway
    100764780 (Tnf)
   04668 TNF signaling pathway
    100764780 (Tnf)
   04071 Sphingolipid signaling pathway
    100764780 (Tnf)
   04150 mTOR signaling pathway
    100764780 (Tnf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100764780 (Tnf)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100764780 (Tnf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100764780 (Tnf)
   04217 Necroptosis
    100764780 (Tnf)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100764780 (Tnf)
   04620 Toll-like receptor signaling pathway
    100764780 (Tnf)
   04621 NOD-like receptor signaling pathway
    100764780 (Tnf)
   04622 RIG-I-like receptor signaling pathway
    100764780 (Tnf)
   04625 C-type lectin receptor signaling pathway
    100764780 (Tnf)
   04650 Natural killer cell mediated cytotoxicity
    100764780 (Tnf)
   04612 Antigen processing and presentation
    100764780 (Tnf)
   04660 T cell receptor signaling pathway
    100764780 (Tnf)
   04657 IL-17 signaling pathway
    100764780 (Tnf)
   04664 Fc epsilon RI signaling pathway
    100764780 (Tnf)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100764780 (Tnf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100764780 (Tnf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100764780 (Tnf)
  09163 Immune disease
   05310 Asthma
    100764780 (Tnf)
   05322 Systemic lupus erythematosus
    100764780 (Tnf)
   05323 Rheumatoid arthritis
    100764780 (Tnf)
   05321 Inflammatory bowel disease
    100764780 (Tnf)
   05330 Allograft rejection
    100764780 (Tnf)
   05332 Graft-versus-host disease
    100764780 (Tnf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100764780 (Tnf)
   05014 Amyotrophic lateral sclerosis
    100764780 (Tnf)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100764780 (Tnf)
   05410 Hypertrophic cardiomyopathy
    100764780 (Tnf)
   05414 Dilated cardiomyopathy
    100764780 (Tnf)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100764780 (Tnf)
   04940 Type I diabetes mellitus
    100764780 (Tnf)
   04932 Non-alcoholic fatty liver disease
    100764780 (Tnf)
   04931 Insulin resistance
    100764780 (Tnf)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100764780 (Tnf)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100764780 (Tnf)
   05135 Yersinia infection
    100764780 (Tnf)
   05133 Pertussis
    100764780 (Tnf)
   05134 Legionellosis
    100764780 (Tnf)
   05152 Tuberculosis
    100764780 (Tnf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100764780 (Tnf)
   05170 Human immunodeficiency virus 1 infection
    100764780 (Tnf)
   05164 Influenza A
    100764780 (Tnf)
   05161 Hepatitis B
    100764780 (Tnf)
   05160 Hepatitis C
    100764780 (Tnf)
   05168 Herpes simplex virus 1 infection
    100764780 (Tnf)
   05163 Human cytomegalovirus infection
    100764780 (Tnf)
   05169 Epstein-Barr virus infection
    100764780 (Tnf)
   05165 Human papillomavirus infection
    100764780 (Tnf)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100764780 (Tnf)
   05144 Malaria
    100764780 (Tnf)
   05145 Toxoplasmosis
    100764780 (Tnf)
   05140 Leishmaniasis
    100764780 (Tnf)
   05142 Chagas disease
    100764780 (Tnf)
   05143 African trypanosomiasis
    100764780 (Tnf)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100764780 (Tnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100764780 (Tnf)
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100764780 (Tnf)
Cytokines and growth factors [BR:cge04052]
 Cytokines
  Tumor necrosis fators
   100764780 (Tnf)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Haparin
  Cytokines
   100764780 (Tnf)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100764780
NCBI-ProteinID: XP_027244471
Position
1
AA seq 234 aa
MSTESMIRDVELAEEALPKKAWGPQNSSRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR
EEKFPNNPIIGSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMS
LKDNQLVIPADGLYLVYSQVLFTGQGCSNYVLLTHTVSRIAVSYEDKVNLLSAIKSPCPK
ETPEGAELKPWYEPIYLGGVFQLEKGDRLSAEVNLPKYLDFAESGQVYFGVIAL
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagcacagaaagcatgatccgcgacgtggagctggcagaggaggcactccccaaaaag
gcgtggggcccccagaactccagccggtgcctatgtctcagcctcttctccttcctgctt
gtggcaggggccaccaccctcttctgtctgctgaactttggagtgatcggcccccaaagg
gaagagaagttcccgaacaaccctatcataggctccatggcccagacactcacactcagg
tcatcttctcaaaattcgagtgacaagcctgtagcccacgttgtagcaaaccaccaagtg
gaggagcagctggagtggctgagccagcgtgccaatgccctcctggccaacggcatgtct
ctcaaagacaaccagctggtgattccagcggatgggctgtacctcgtctactcccaggtt
ctcttcacgggccaaggctgctccaactacgtgctcctcacccacactgtcagccgcatt
gctgtctcctacgaggataaagtcaacctcctgtctgccatcaagagcccctgccccaag
gaaacccctgagggggcggagctcaagccctggtacgagcccatctacctgggaggggtc
ttccagctggagaaaggcgaccgactgagtgccgaggtcaacctgcctaaatacttagat
tttgcagaatccgggcaggtctactttggagtcatcgctctgtga

DBGET integrated database retrieval system