KEGG   Cricetulus griseus (Chinese hamster): 100766362
Entry
100766362         CDS       T02813                                 

Gene name
Tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase TM7SF2 isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00100  Steroid biosynthesis
cge01100  Metabolic pathways
Module
cge_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100766362 (Tm7sf2)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100766362 (Tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 100766362
NCBI-ProteinID: XP_035297915
Position
3
AA seq 524 aa
MVRARRLLGIWRQKDGGCAGGRMSAGKDGPVLAAVQQGVCGVGDSWKSRRIVLGRTKMEI
KVGVWRREPAKQAGDLRCLWTWESSGERSRDTVALSPGVTAMLVLLPATMFHLLLVARSG
PARLLGPPTYLPGLEELWSPQALLLLFIWLALQVALYLLPARKVAEGLELKDKSRLRYPI
NGFQALVLTALLVGLGVSAGLPLGALPEMLLPLAFATTLTSFIFSLLLYMKALAAPVSAL
APGGNSGEKGPNEVGVRHMGCLTVPSLSVIPPGNCIYDFFLGRELNPRLGSFDFKYFCEL
RPGLIGWVFINLALLIQEAELRGSPSLAMWLVNAFQLLYVGDALWYEESVLTTMDIIHDG
FGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALLICLIKVIGYYIFRGANSQKNTF
RKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYF
YLLYFTALLVHREARDEQQCLRKYGRAWQEYCKRVPYRIIPYVY
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggtacgagctagaaggcttttgggaatttggaggcagaaagatggagggtgcgcaggt
ggcagaatgtctgcaggaaaggatggaccggtgctggcagctgtacagcaaggagtctgt
ggagtgggagacagttggaagagcaggaggatagtcttggggaggactaagatggaaatc
aaggtaggagtatggcgcagggaacctgctaagcaggcaggtgacctaaggtgcctgtgg
acttgggagagctctggggagcggtcacgagacacagtggccctctctccaggcgtcacg
gcgatgctggtcctgctgcctgccaccatgttccatctgctcctggtggcccgatcgggc
ccagcgcggctcctgggcccacccacttacctgccggggctggaggagctgtggagtcca
caggctctgctgctattgttcatctggctcgccctgcaggtggcgctctatctgctgcct
gcgcgcaaggtggccgaagggctggaactaaaggacaagagtcgcctgcgctaccctatt
aatggcttccaggctctggtcctaacagccctgttggtggggctaggggtgtcagctggg
ctgcccctgggggcactccctgaaatgctcctgcccttggcctttgcgaccactctcacc
agcttcatcttcagcctccttctctatatgaaggctttggcagctcctgtctcagccctg
gcacctggaggaaactcaggtgagaagggtcccaatgaggtaggggtgaggcatatggga
tgcctaactgtgccttcactctctgttattcccccaggaaattgcatttatgatttcttt
ctgggacgggagctaaaccctcgccttggttcctttgacttcaaatatttctgtgagctg
aggcctggcctcatcggctgggtttttattaacctggccctgctgatacaggaggcagag
ctacgggggagtccttcactggccatgtggctggtcaatgccttccagttgctgtatgtg
ggtgatgccctctggtatgaggagtctgtcctcaccaccatggacataatacatgatgga
tttggtttcatgctggcctttggagacctagcctgggtacccttcacctacagcttgcag
gcccagttcctgctataccatccacagcctctggggttgcccatggccttgctcatctgc
cttattaaggttattggttactacatcttccgtggtgctaactcccagaaaaacacattc
cggaagaatccttctgaccccagtgtggctggtcttgaaaccatccctactgccacagga
cggcagctgctggtatctgggtggtggggtatggttcgtcaccccaactacttgggagac
ctcatcatggctctggcctggtccttgccctgtggggtgtctcacctgctgccctacttc
tacctcctttacttcactgcattgctggtacaccgggaggcccgagatgagcagcagtgc
cttcgcaagtatggccgtgcctggcaggaatactgcaaacgtgtgccttatcgaatcata
ccctatgtctactga

DBGET integrated database retrieval system