KEGG   Cricetulus griseus (Chinese hamster): 100766430Help
Entry
100766430         CDS       T02813                                 

Gene name
Minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X2
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00562  Inositol phosphate metabolism
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100766430 (Minpp1)
   00562 Inositol phosphate metabolism
    100766430 (Minpp1)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100766430 (Minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100766430 (Minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 100766430
NCBI-ProteinID: XP_027262200
Position
3
AA seq 481 aa AA seqDB search
MLSGPRTRLPASVAPAAVLAAALLSSFARCSLPGRGDPVASVLSPYFGTKTRYEDVNPWL
LVDPVAPRRDPELLAGTCTPVQLVALIRHGTRYPTTKQIRKLRQLQGLLRTRGPGDRGGG
VGAALVEWPLWYDDWMDGQLVEKGRQDMRQLALRLAALFPDLFSRENYGRLRLVTSSKHR
CVDSSAAFLQGLWQHCHPGLPPPDVSDMECDPPRINDKLMRFFDHCEKFLTDVERNESAL
YHVEAFKTGPEMQKILNKVAATLQVPVSSLNADLVQVAFFTCSFDLAIKGVHSPWCDVFD
VDDAKVLEYLNDLKQYWKRSYGYTINSRSSCTLFQDIFLHLDKAVEQKQRSQPISSPVIL
QFGHAETLLPLLSLMGYFKDKEPLTAYNFKEQAHRKFRSGHIVPYASNLIFVLYHCENAK
TPQEEFQVQMLLNEKVLPLAHSQETVALYEDLKNHYKDILQSCQTSKECNLPKVNITSDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgctctccggcccccgcacccgcctcccggcctcggtcgcgcccgccgcggtcctggct
gcggcgctgctctcgtcgttcgcgcgctgctctctcccggggcgcggcgacccggtggct
tcggtgctcagcccctacttcggcacgaagactcgctacgaagatgtcaacccctggctg
ctggtcgacccggtggcgccgcggcgggacccggagctgctggcggggacctgcaccccg
gtgcagctggtcgccctcatccgtcacggcacccgctacccgacgaccaagcagatccgc
aagctgaggcagctgcaggggctgctgcggacccggggacccggggaccgcgggggcgga
gtgggcgccgcgctggtggagtggccgctgtggtacgatgactggatggacgggcagctg
gtggagaaggggcggcaggacatgcgacagctggcgctgcgcctggccgccctcttccca
gatctcttcagccgggagaactacggccgcctgcggctggtcaccagctccaagcaccgc
tgtgtggacagcagcgccgccttcctccaagggctgtggcaacactgccacccgggactg
ccaccgcccgacgtctcagatatggagtgtgaccctccaagaattaatgataaactaatg
aggttcttcgatcattgtgagaaatttttaactgacgtggaaagaaatgagtcagctctt
tatcatgtagaagccttcaaaactggacctgaaatgcagaagattttaaacaaagttgca
gctactttgcaagtgccagtaagcagtttaaatgcagacttagttcaggtggcttttttc
acctgttcatttgacctggcaattaaaggtgtccattctccgtggtgtgatgtgtttgat
gtagatgatgcaaaggtactggaatatttaaatgatctgaaacagtattggaaacgaagt
tacggctataccattaacagccgatccagctgcaccctgtttcaggatatctttctacac
ctggacaaagccgttgagcagaagcaaaggtctcagccgatttcttctccagtcatcctc
cagtttggtcatgcagagaccctcctgccgctgctctcgctcatgggctatttcaaagat
aaggagcccctgacagcatataattttaaggagcaagcccatcgaaagttccgaagtggt
cacatcgtaccttatgcctcgaacctgatatttgtgctttaccattgtgaaaacgcaaag
acccctcaagaagaattccaagtacagatgctgctgaatgaaaaagtgttacccttggct
cactcacaagaaaccgttgccttgtacgaggatctgaagaaccactacaaggacattctt
cagagctgtcaaaccagcaaagaatgtaacctacccaaagtgaacatcacatccgatgag
ctgtga

DBGET integrated database retrieval system