KEGG   Cricetulus griseus (Chinese hamster): 100766818Help
Entry
100766818         CDS       T02813                                 

Gene name
Insr
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04072  Phospholipase D signaling pathway
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04520  Adherens junction
cge04910  Insulin signaling pathway
cge04913  Ovarian steroidogenesis
cge04923  Regulation of lipolysis in adipocytes
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge04960  Aldosterone-regulated sodium reabsorption
Module
cge_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100766818 (Insr)
   04015 Rap1 signaling pathway
    100766818 (Insr)
   04010 MAPK signaling pathway
    100766818 (Insr)
   04066 HIF-1 signaling pathway
    100766818 (Insr)
   04068 FoxO signaling pathway
    100766818 (Insr)
   04072 Phospholipase D signaling pathway
    100766818 (Insr)
   04022 cGMP - PKG signaling pathway
    100766818 (Insr)
   04151 PI3K-Akt signaling pathway
    100766818 (Insr)
   04152 AMPK signaling pathway
    100766818 (Insr)
   04150 mTOR signaling pathway
    100766818 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100766818 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100766818 (Insr)
   04923 Regulation of lipolysis in adipocyte
    100766818 (Insr)
   04913 Ovarian Steroidogenesis
    100766818 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100766818 (Insr)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100766818 (Insr)
   04213 Longevity regulating pathway - multiple species
    100766818 (Insr)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100766818 (Insr)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100766818 (Insr)
   04931 Insulin resistance
    100766818 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100766818 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:cge04090]
    100766818 (Insr)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100766818 (Insr)
Protein kinases [BR:cge01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100766818 (Insr)
CD molecules [BR:cge04090]
 Proteins
  100766818 (Insr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 DUF4476 Kinase-like
Motif
Other DBs
NCBI-GeneID: 100766818
NCBI-ProteinID: XP_007633480
Position
Un
AA seq 1372 aa AA seqDB search
MGSGRRRETTAAPLLVAVAALLVGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHYKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILDGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDESSSECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLDEVGNVTATMPTLPDFPNISSTVVPT
SQEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEAKA
DDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERG
CRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSV
VIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLRELG
QGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLL
GVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYL
NAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKD
GVFTASSDMCSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLEPPDNCPERLTDLMR
MCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELEMEFEDMENVPLD
GSSHCHREEAGCREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPRSNPS
NT seq 4119 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgggagacgacgggagacgacggccgcgccgttgctggtggctgtggccgcg
ttgctggtgggcgcagccggccacctgtaccccggagaggtatgccctggcatggacatc
cggaacaacttgaccaggctgcatgagctggagaactgctctgttattgagggccatctg
cagatcctcctgatgttcaaaaccaggcctgaagacttccgagacctcagtttccccaaa
ctcatcatgatcacagactacctgcttcttttccgagtctatggcctggagagtctgaaa
gacctcttccccaaccttacagtcatccgaggctcccgccttttcttcaactatgccctg
gtcatctttgagatggttcacctgaaggagctggggctttacaacctcatgaacatcacc
cggggctctgtccgcattgagaagaataacgagctctgctacctggccaccattgactgg
tcccggatcctggattctgtggaggacaactacatcgtgctgaacaaagatgacaatgag
gaatgtggggatgtctgtccaggcaccgccaagggcaagaccaattgccctgccaccgtc
atcaatgggcagtttgtggaacggtgctggacacatagtcattgtcagaaagtttgcccg
accatctgtaagtcacatggttgcacagctgaaggcctgtgctgccacaaggagtgccta
ggcaactgttcggaaccggacgaccccactaagtgtgtggcctgccgcaacttctacctg
gacggtcggtgtgtggagacctgcccgcccccctactaccacttccaggattggcgctgt
gtgaacttcagcttctgtcaagaccttcactacaaatgcaggaactctaggaagcctggc
tgtcaccaatacgtcattcacaacaacaagtgcatccctgagtgtccttctggctatacc
atgaattccagcaacttgatgtgcaccccatgtctgggaccctgtcctaaggtctgccag
atcctggatggcgagaagaccattgactctgtgacatctgcccaggagctccgaggctgc
accgtgatcaatggcagcctcatcattaacatccgagggggcaacaacctggcagctgag
ctggaggctaaccttggcctcattgaagaaatttcagggttcctaaaaatccggcgttcc
tatgctctggtatctctttctttcttccggaagctccatctgattcgaggagagaccttg
gaaatcgggaactactctttctacgccttggacaaccagaacctcaggcagctctgggac
tggagcaaacacaacctcaccatcactcagggcaagctcttcttccactacaaccccaaa
ctctgcttgtcagaaattcacaagatggaagaagtttctggaactaagggccgccaggag
aggaacgacattgccctgaagaccaatggcgaccaggcatcctgtgaaaatgagttactt
aaattttctttcattcggacatcttttgacaagatcttgctgaggtgggagccctactgg
ccccctgatttccgagacctcctgggattcatgctcttctacaaagaggccccgtatcag
aatgtgacagagtttgatgggcaggatgcttgtggctccaacagctggaccgtggtagat
attgacccaccccaaaggtccaacgaccccaagtctcagaccccaagccaccctgggtgg
ctaatgcggggtctcaagccctggactcaatatgccatctttgtcaagaccttggttacc
ttctctgatgaacgccggacctacggagccaaaagtgacatcatctatgtgcagacagat
gccactaacccttctgtccccttggaccccatatcagtttctaattcctcatctcagatt
attttaaagtggaagcccccctccgaccccaatggcaacatcacacactacctggtctac
tgggagaggcaggcggaggacagcgagctgtttgagttggattattgtctcaaagggctg
aagctcccctcacggacctggtccccaccttttgaatcggatgattctcagaagcataat
cagagcgagtatgacgagtcgtccagtgaatgctgctcatgccccaagactgactctcag
atcctcaaggagctggaggaatcctcattcaggaagacctttgaggattacctgcataac
gtggtgtttgtccccaggccatcccgaaaacgaagatcccttgacgaggtggggaatgtg
acagccaccatgcccacacttccagattttcccaacatctcttccaccgttgtgcccacg
agtcaggaagagcacaggccatttgagaaagtggtgaacaaggaatcacttgtcatctct
ggcctgagacacttcactggctaccgcattgagctgcaggcctgcaaccaagactcccca
gatgagaggtgcagtgtggctgcctacgtcagtgcccgaaccatgcctgaagctaaggca
gatgacatcgttggccctgtgacccatgaaatctttgagaacaatgttgtacacttaatg
tggcaagagccaaaggagcccaatggtctgattgtgctgtatgaagtgagctaccggcgc
tatggtgatgaggagctgcacctctgtgtctcccggaagcattttgccctggagcggggc
tgtagacttcgagggctctccccaggaaactacagtgttcgagtccgggctacctccctg
gcaggcaatggctcctggacagaacccacctatttttatgtgaccgattatttagatgtc
ccatcaaatattgccaaaattatcatcgggcctctcatctttgtcttcctcttcagtgtt
gtgattggaagtatttatctgttcctgagaaagaggcagccggatggaccaatgggacca
ttgtatgcatcttcaaaccctgagtacctcagtgccagtgatgtgtttccttcttctgtg
tacgtgccggatgagtgggaggtgcctcgagagaagatcaccctcctacgagagctgggc
cagggatcctttggtatggtgtatgaaggcaatgccaaggatatcatcaagggtgaggca
gagacacgagttgcagtgaagactgtcaatgagtcagccagtctccgagaacgaattgag
ttcctcaacgaggcatcggtcatgaagggattcacctgccatcatgtggtccgcctcctt
ggggtagtgtccaagggccagccaacattggtggtgatggaattgatggctcatggagac
ctgaagagtcacctccgttctctgcgaccggatgctgagaataacccgggccgtcctccc
cctaccttgcaagaaatgattcagatgacagcagaaattgccgatggcatggcatacttg
aatgccaagaagtttgtgcaccgggacctggcagctcgaaattgcatggttgctcatgac
tttaccgtcaaaattggagactttggaatgacgagggatatctacgagacagattactat
cggaaagggggcaagggcctgctgcctgtgcggtggatgtcacctgagtccttgaaggat
ggagtctttaccgcttcttctgatatgtgttcctttggggtggtcctttgggaaatcacc
agcctggctgagcaaccttaccaaggcctgtctaatgaacaggtgttgaaatttgtcatg
gatggaggctatctggagccacctgataattgtcctgagagactcacggacctgatgcgc
atgtgctggcagttcaaccccaagatgaggccaaccttcctggaaattgtcaacctgctc
aaggatgacctccacccgagctttccagaagtttccttcttctacagcgaagagaacaag
gctcctgagagcgaggagctggagatggagtttgaggacatggagaatgtccccttggat
gggtcctctcactgtcatagggaagaggctgggtgccgggagggagggtcctctctgagc
attaaacggacctatgacgaacacatcccgtacacccacatgaacgggggcaagaagaac
gggcgcgtgctcaccctgcccaggtccaacccttcctaa

DBGET integrated database retrieval system