KEGG   Cricetulus griseus (Chinese hamster): 100767102Help
Entry
100767102         CDS       T02813                                 

Gene name
Pik3c2b
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00562  Inositol phosphate metabolism
cge01100  Metabolic pathways
cge04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100767102 (Pik3c2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100767102 (Pik3c2b)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     100767102 (Pik3c2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 HEAT_2
Motif
Other DBs
NCBI-GeneID: 100767102
NCBI-ProteinID: XP_027273416
Position
5
AA seq 1633 aa AA seqDB search
MSSIQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHHKEESRAKQNTEPSLISW
EEPALDFYNKPAGRRTDLKLLRGLSGSDPTLNYNSISPPEELSNSTSQDPQPGPDPWPKG
SLPGDYLYIFDGSDGRLSLSPGSGDTDGSCKKLSPPPLPPRVSIWDAPPLPPRKGSPSPS
KIPQPNDINSFSLVEQPPDKLLGPQDPEEEELPDGGGQRHMLGSVDYDGINDAITRLNLK
STYDSEILSDATRGWKEGRGPLDFNKDTSGKPVARSKTMPPQVPPRTYTSRYANRKNATP
GKNRRISAAPVGSRPHTTASGHELFEVSEERDEEVAAFCHMLDILRTGSDIQDYSLTGYV
WSAVTPSPEHLGDEVNLKVTVLCDSLREPLTFTCNCSSTVDLLIYQTLCYTHDELREVDV
GDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDINIRLQLMEQKAIRSDLARTVNDDQSP
STLNYLIHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAICN
ALAAVETPEITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELYC
NTFNADFQTAVPGSRKHDLVQEACHFSGALAFTVYATHRIPIIWATSYEDFYLSCSLSHG
GKELCSPLQTRRAHFSKYLFHLIIWDQQICFPVQVNRLPRETLLCATLYALPIPPPGSSS
EANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENSSARWSAPNFHQPDSVIL
QIDFPTSAFDIKFTSPPGDKFSPRYEFGSLREEDQRKLKDITQKESLYWLTDADKKHLWE
KRYYCHSEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGLLHATFPDQEVRR
MAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAISDLRVTHYFFWLLKDS
LKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNTLAKLAQQVREATPSARQGILRN
GLEEVRQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLAFQNVDPLGENIRVI
FKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRKI
QVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYILGICDRHNDNI
MLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDLC
CQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLIE
SSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFAPRTHTLKSSGRITDVFLCRREKVFHP
SKGYIYVVKVMRENAHEATYIQRTFEEFQELHNKLRLLFPSSFLPSFPSRFVIGRSRGEA
VAERRKEELNGYIWHLIHAAPEVAECDLVYTFFHPLPRDEKASGTSPAPKSSDGTWARPI
GKVGGEVKLSISYKNNKLFIMVMYIRGLQPLQDGNDPDPYVKIYLLPDPQKTTKRKTKVA
RKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVHIRLRELDLAQEKT
GWFALGSRGHGTL
NT seq 4902 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgattcagggcaatggggaacactggaagtccctagagtcggtgggcatcagc
cgcaaagaactggctatggctgaagccctgcagatggagtatgatgctctttcccggctc
cgacatcacaaggaggagagcagggccaagcagaacacagagccctctctcatcagctgg
gaagagccagccttagacttctacaacaagccagcaggcaggcggacagacctcaagctc
ttgcgtggcctttctggctctgatcctaccctgaattacaactccatctccccaccagaa
gagctctccaactctacctcccaagatccccagcctggcccagatccctggcccaagggc
tccctgcctggagactatctctatatttttgatggctcagatgggaggctctccttgtct
ccaggatcaggtgacacagatggctcttgcaagaagttatccccacctcctctgcctcct
cgggtctctatctgggatgcccctcccttgcctcccagaaaggggtccccctcaccctcc
aagatccctcagcctaatgacatcaacagtttttctttggtggaacagccacctgacaaa
ctattagggccccaggacccagaagaggaagagctacctgatggtggaggacagcgacat
atgctgggatctgtggactatgatggcattaatgatgcaattacaaggctcaacttgaag
tcaacttatgattccgaaatattgtctgatgctacgaggggctggaaggagggtcggggg
cccctggacttcaacaaggacacctctggaaaacctgtggcccggagcaagacgatgccc
cctcaggtgcccccccgaacctatacttcccgatatgccaacagaaaaaatgcaacacct
ggcaagaaccgccggatttctgctgctccggtgggctcccggccccacaccaccgccagt
ggccacgaattgtttgaggtctcagaggagagagatgaggaagttgctgcattttgccac
atgctggatatccttcggacaggctctgacatccaggactactccctaactggatatgtc
tggagcgctgtcaccccgagcccagagcatcttggggatgaagtcaacctgaaggtgact
gtgttgtgtgacagtcttcgggagccactcacttttacctgcaactgctcctctactgtg
gacttgctcatttaccagaccctctgctacacccacgatgaactgagggaagtggatgtg
ggggactttgtgctgaagccctgtgggctggaggaattcctacaaaataagcatgccttg
ggcagccatgagtatatccaatattgccgcaagtttgacatcaacatccgactacagctg
atggagcagaaagccatacggagtgacctggcccggacggtaaatgatgaccagagccct
tccaccttgaactacctcatccatctccaagagaggccagtcaagcagaccatcagcagg
caggccttgagtcttctgtttgacacttaccacaatgaggtggatgccttcctgctggct
gatggggatttcccgctgaaggcggacagggtggtccagtctgtcaaggccatctgcaat
gccctggctgccgtggagactcctgagatcaccagtgctctcaaccagctgcctccctgc
ccttcacgcatgcagccaaaaatccagaaggatcccagtgtgttggctgtgagggaaaac
cgagagaaggtggtagaagccttgacagcagccatcttggacttggtggagctgtactgc
aatacattcaatgcagacttccagacggcagtgcctggcagtcgaaagcatgatttggtt
caagaggcctgccatttctctggggctctggccttcactgtctatgccactcaccgcatt
cccatcatctgggctacgagctatgaagatttctacctctcctgttccctcagccatgga
ggcaaggaactatgcagtcccctgcagacccgacgggctcacttctccaagtatttgttc
cacctcatcatctgggaccagcagatctgctttccagtgcaggtgaacaggctgcctcgg
gagaccctgctgtgtgcaacactctatgctctgcccattccgcctcctgggagttcctct
gaagccaacaagcagagacgggtgcctgaggctctgggctgggtcactacccctctcttc
aacttcaggcaagtcttgacctgtggccgcaagcttctgggcttgtggccagcaacacag
gaaaactccagtgcccgttggagtgcacctaatttccaccagccagacagtgtcatcctg
cagattgacttccccacctcggcctttgacatcaagttcaccagcccccctggagacaag
ttcagcccccgctatgagtttggcagcctccgggaggaggaccaacgcaagcttaaagac
atcacgcagaaggagtccctatactggctcaccgacgctgacaagaagcacctgtgggag
aaacgctattactgccactccgaggtgagctcactgcccctggtactcgccagtgcaccc
agctgggagtgggcttgcctgcccgacatctatgctctcctgaagcagtggacacacatg
aaccaccaggatgccctggggctcctgcatgccaccttcccggaccaggaggtgcggcgg
atggccgtgcagtggattggctccctctcagatgcagaactgctggactacctgccccag
ctagtacaggccctgaagtatgagtgctacctggatagccccttggtgcgctttctcctg
aagcgagccatctctgacctgagagtgacccactacttcttctggctactgaaggatagc
ctcaaggactctcagttcagcatccgctaccaatacctgctggcagccctgctatgctgc
tgtggcaagggactaagggaggagtttaaccgccagtgctggcttgtcaataccctggcc
aaactggcccagcaggtccgagaggccaccccatctgcacgccagggcatccttcgaaat
ggcttggaggaggtgaggcagttctttgccctcaatggttcgtgccgtctgccacttagc
cccagtctgctggtgaagggtatcgtgcccagggactgttcctacttcaattccaacgca
gtccccctcaaactcgccttccaaaatgtggatcccctgggcgagaacatccgggtcatc
ttcaagtgcggggacgaccttcgccaggacatgctcaccttgcagatgattcgaatcatg
agcaagatctgggtgcaggaggggctggatatgcgcatggtcattttccgctgcttctcc
accggccgagggagagggatggtagagatgatacccaacgctgagacactgcgcaagatc
caggtggagcacggggtgactggctccttcaaggaccgccccctggctgactggctacag
aaacacaaccctggagaggatgaatatgaaaaggctgtggagaacttcatctactcctgt
gctggctgctgtgtggctacatacatcctgggcatctgtgacagacacaatgacaacatc
atgctgaagaccaccggacacatgttccatatagattttggccgcttcctgggccacgcg
cagatgtttggcaatatcaagagggaccgtgccccctttgtcttcacctcggacatggcg
tatgtcatcaacgggggtgacaagccttccagccggttccatgattttgttgacctttgc
tgccaagcctacaacctcatccgcaagcacacccacctcttcctcaaccttctgggcctg
atgttgtcctgtggaatccctgagctctccgacctggaggacctcaagtatgtgtatgat
gccctgaggcctcaggacacagaggccaatgccaccacatacttcacaaggttgattgag
tccagcctgggcagcgtagccacgaaactcaacttcttcatccataacctggctcagatg
aagttcacaggctcagatgatcggctgaccctttccttcgcgccccgaacacatactctc
aagagctctggccgcatcactgatgtttttctctgccgtcgtgagaaagttttccacccc
agcaagggctatatatatgtggtgaaggtgatgcgagagaatgctcatgaggcaacttac
atccagaggacctttgaggagttccaggaactacacaataagctgcgcctgctcttcccg
tcttccttcctgcccagctttcctagtcgctttgtgattggccgctcccggggagaggca
gtggctgagcggaggaaagaggaactaaatggctacatctggcacttgattcatgcagcc
ccagaggtggctgagtgtgatctagtatataccttcttccaccccctgcctcgggatgaa
aaggcttcaggcaccagcccagctccaaagtcctcagatgggacatgggcccggcccatt
gggaaggtcggtggggaggtgaagctgtccatctcctacaaaaacaacaaactcttcatc
atggtgatgtatattcggggcttgcagccgctccaagatgggaatgaccctgatccctat
gtaaagatttacctccttcctgaccctcagaagaccacaaagaggaaaacgaaagtggcc
cggaaaacctgtaaccctacctacaatgagatgttggtgtatgatgggatccccaaggga
gacctgcagcagcgggagctccagctgagcgtgctaagtgagcaaggattttgggagaac
gtactccttggcgaggtgcacatccgccttcgggagctggacctggcccaggagaagact
ggctggtttgccctgggatctcgaggtcacggaaccttatga

DBGET integrated database retrieval system