KEGG   Cricetulus griseus (Chinese hamster): 100767432Help
Entry
100767432         CDS       T02813                                 

Gene name
Qrsl1
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial isoform X1
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00970  Aminoacyl-tRNA biosynthesis
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100767432 (Qrsl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cge03029]
    100767432 (Qrsl1)
Enzymes [BR:cge01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100767432 (Qrsl1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100767432 (Qrsl1)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100767432 (Qrsl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 100767432
NCBI-ProteinID: XP_027258055
Position
2
AA seq 523 aa AA seqDB search
MLGRTLREVSAALKQGQVTPTELCKKCLSIIKKTKYLNAYITVSEEVALKQAEESEKRHK
QGQPLGDLDGIPVAVKDNFSTSGIETTCASNMLKGYIPPYNATVVQKLLDQGALLMGKTN
LDEFAMGSGSTDGVFGPVKNPWSYSKQYRERQRHDEHGDSHWLITGGSSGGSAAAVAAYT
CFAALGSDTGGSTRNPAAHCGLVGFKPSYGLVSRHGLIPLVNSMDVPGIFTRCVDDTAVV
LGVLAGHDPKDSTTVQDPIKLPMILGEMDVSRLCIGIPKEYLVPELSSEIRSLWSQAADL
FESEGAKVIEVSLPHTCYSIVCYHVLCTSEVASNMARFDGLQYGHRSGIDVSTEAMYAAT
RQEGFSDVVRGRILSGNFFLLKENYENYFVKAQKVRRLIVRDFMNAFDSGVDVLLTPTTL
SEAVPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSVPVALSNQGLPIGLQFIGRAFCD
QQLLTVAKWFEKQVQFPTIQLQDLMDDGSLVLENGKLTSVSLT
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctgggccggactctccgagaagtttctgcagcactaaaacagggccaagtcacacca
acagagctctgcaagaaatgtctctctatcatcaagaaaaccaagtatctaaatgcttac
attactgtatcagaagaggtagccttaaagcaagctgaagaatcggagaaaagacacaaa
caaggtcagccacttggagatttagatggaattcctgttgctgtcaaagacaacttcagt
acatctggcattgagacgacatgtgcatcaaatatgctaaaaggttatataccaccttac
aatgctacagtagttcagaaactgttggatcagggagctctactcatggggaaaacaaat
ttagatgagtttgctatggggtctggaagcacagatggtgtgtttggaccagttaaaaac
ccctggagttactcaaagcaatacagagaaaggcagcggcatgatgagcatggtgattcc
cattggctgataactggagggagctcaggtggcagtgcagcagcagtggcagcgtacacg
tgctttgcggctctaggatcagatactggagggtccaccagaaaccctgctgcgcactgt
gggcttgttggtttcaaaccaagttatggcttagtttcccgccatggcctcattcctctg
gtgaattcaatggatgtgccaggaatcttcaccagatgtgtggatgatacagcagttgtg
ttaggtgtactggctggacatgaccccaaagattccaccacagtacaagaccctattaag
ctacccatgattcttggtgagatggatgtaagcagactgtgtataggaatcccaaaggaa
tatctggtaccagagttgtccagtgaaatacggtctctctggtcccaagctgctgacctc
tttgagtctgagggtgccaaagtgattgaagtctccttgccacacacatgctactcaatt
gtctgctaccatgtgctgtgtacatcggaagtagcttcgaatatggcaagatttgatggg
ctacaatatggtcataggtctggcattgatgtgtccactgaagccatgtatgctgcaacc
agacaagaagggttcagtgatgtggtacgaggaagaattctctcaggaaactttttctta
ttaaaagaaaattatgagaattatttcgtcaaggcgcagaaagtgaggcgcctcattgtg
agggatttcatgaatgcttttgactctggtgtggatgttctgctaactcccaccaccctg
agtgaggcagtgccatacttggagttcatcaaagaagacaacaggacacgaagtgcccag
gatgacattttcacacaagctgtaaatatggccggcttgccagcagtgagtgtccctgtg
gccctttcaaaccaagggttaccaataggactgcagttcattggacgtgcattttgtgac
cagcaacttctgacagttgctaaatggtttgaaaaacaagtacagtttcctactattcaa
ctgcaagacctcatggatgatggctcattggttcttgaaaacggaaagttaacttctgtt
tctctaacctaa

DBGET integrated database retrieval system