KEGG   Cricetulus griseus (Chinese hamster): 100767455Help
Entry
100767455         CDS       T02813                                 

Gene name
Mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00561  Glycerolipid metabolism
cge01100  Metabolic pathways
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04923  Regulation of lipolysis in adipocytes
Module
cge_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100767455 (Mgll)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100767455 (Mgll)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100767455 (Mgll)
  09159 Environmental adaptation
   04714 Thermogenesis
    100767455 (Mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cge01002]
    100767455 (Mgll)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100767455 (Mgll)
Peptidases [BR:cge01002]
 Serine Peptidases
  Family S33
   100767455 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 LIDHydrolase Abhydrolase_3 Abhydrolase_5 Peptidase_S9 Thioesterase PGAP1 Abhydrolase_2 Ser_hydrolase BAAT_C DUF2974 DUF1057
Motif
Other DBs
NCBI-GeneID: 100767455
NCBI-ProteinID: XP_003500268
Position
Un
AA seq 313 aa AA seqDB search
METGPEDLNRMPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYDELAQMLKGLGMMVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKD
YPGVPVFLLGHSMGGAISILAAAERPAHFSGMVLISPLVLANPESASTFKVLAAKVLNLV
LPNMSLGRIDSSVLSRNKSEVDIYDSDPLICRAGVKVCFGIQLLNAVSRVERAMPKLTLP
FLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHKELPEVTKSVLHEINMWL
SHRTAATGAGCPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagggccagaagacctcaacaggatgcctgaggcaagttctcccaggcgaact
ccccagaatgtcccctaccaggacctgcctcacctggtcaacgcagacggacagtacctc
ttttgtaggtactggaaacccactggcacacccaaggccctcatctttgtgtcccatggt
gctggggagcactgcggccgttatgatgagctggctcagatgctgaaggggctgggcatg
atggtattcgcccatgaccacgttggccatgggcagagtgaaggagagaggatggtggta
tcagacttccaggtttttgtcagagacgtgctgcagcatgtggacaccattcagaaggac
taccctggggtccccgtcttcctcctgggccactccatgggcggtgccatctccatcctc
gcggctgcagagagaccagcccacttctctggcatggtcctcatctcacctctggttctt
gccaatccagaatctgcatcgactttcaaggtccttgctgccaaagtgctcaaccttgtc
ctgccaaacatgtccttggggcgcattgactccagcgtgctgtctcggaacaagtcggag
gtggacatatacgactccgacccactcatctgccgcgcaggggtaaaggtgtgctttggc
atacagctgctgaacgccgtctcgagggtggagcgcgcgatgcccaagctgacactgcca
ttcctgctgctgcagggttctgctgaccggctgtgtgacagcaaaggtgcctacctgctc
atggaatcatcccggagtcaggacaagacactcaagatgtatgaaggtgcctaccacgtt
ctccacaaggaacttccagaagtgaccaagtccgtcctccatgaaataaatatgtggctt
tctcacaggacagcagcaacaggcgctgggtgcccaccctga

DBGET integrated database retrieval system