KEGG   Cricetulus griseus (Chinese hamster): 100768332
Entry
100768332         CDS       T02813                                 

Gene name
Gtf2f2
Definition
(RefSeq) general transcription factor IIF subunit 2
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:3.6.4.12]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100768332 (Gtf2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cge03021]
    100768332 (Gtf2f2)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100768332 (Gtf2f2)
Transcription machinery [BR:cge03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     100768332 (Gtf2f2)
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N
Other DBs
NCBI-GeneID: 100768332
NCBI-ProteinID: XP_027245923
UniProt: G3H834
Position
1
AA seq 249 aa
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGIQNVKGIHKNTWELKPEYR
HYQAEEKSD
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcggagcgcggggaactggatctgaccggcgccaaacagaacaccggcgtgtggctg
gtcaaggttcctaaatatttgtcccagcaatgggctaaagcccctggaagaggtgaagtt
gggaaactgaggattgccaagaatcaaggaaggactgaggtatcgtttactttaaacgag
gatcttgcaaatattcatgatattggtgggaaaccagcttcagtcagtgctcctagagag
catccatttgtcttgcaaagtgttggaggacagacgttaacagtatttaccgagagctcc
tcagataaactgtcattggaaggaatagtggtacagagagcggaatgccgacctgctgcc
agtgaaaactacatgagattaaagagattgcaaatagaagagtcttccaaacctgtaagg
ctatcacaacagctggacaaagttgtaacaaccaattacaagcctgttgctaaccatcaa
tacaatattgaatatgaaaggaagaagaaagaagatggaaagcgagcccgggcagacaaa
caacacgtcctggacatgctgttttccgcctttgagaagcatcagtactataatctcaag
gatttggtggatatcacaaagcagcccgtgggttacctgaaagaaatcttgaaagaaatc
ggcattcagaatgtaaaagggattcacaagaatacgtgggagctgaagccggaatacagg
cattaccaagctgaagagaagagtgactga

DBGET integrated database retrieval system