KEGG   Cricetulus griseus (Chinese hamster): 100768613Help
Entry
100768613         CDS       T02813                                 

Gene name
Eif4ebp2
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 2 isoform X2
  KO
K18644  eukaryotic translation initiation factor 4E binding protein 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03013  RNA transport
cge04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100768613 (Eif4ebp2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100768613 (Eif4ebp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cge03019]
    100768613 (Eif4ebp2)
Messenger RNA biogenesis [BR:cge03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100768613 (Eif4ebp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF_4EBP
Motif
Other DBs
NCBI-GeneID: 100768613
NCBI-ProteinID: XP_027244089
Position
1
AA seq 120 aa AA seqDB search
MSASAGGGHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLL
DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgtctgcaggcggcggccaccagcccagccagagccgcgccatccccacgcgc
accgtggccatcagcgacgccgcgcagctacctcaggactactgcaccacgcccgggggg
acgctgttctccaccacgccgggaggaacacgaatcatttatgaccgaaagtttctgttg
gatcgacgcaattctcccatggcacagaccccgccttgccatctgcccaatatccctgga
gtcaccagccctggcaccttaattgaagactccaaagtagaagtgaacaacttgaacaac
ctgaacaatcacgacaggaagcatgcagttggagatgaggctcagtttgaaatggacatc
tga

DBGET integrated database retrieval system