KEGG   Cricetulus griseus (Chinese hamster): 100768628
Entry
100768628         CDS       T02813                                 

Gene name
Mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X7
  KO
K04462  ecotropic virus integration site 1 protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge05200  Pathways in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100768628 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768628 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100768628 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100768628 (Mecom)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100768628 (Mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_11 zf-C2H2_8 Sigma54_activat zf-met PyrI_C
Other DBs
NCBI-GeneID: 100768628
NCBI-ProteinID: XP_027247829
Position
1
AA seq 1243 aa
MRSKGRARKLATSNECAYGNYPEIPLEEMPDVDADGIANVPSLHIQEPCSPATSSESFPP
KDGSPYKAPIYIPDDIPIPDEFELRESNMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLK
DSSYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVAD
IAPGEELLLFMKSEDDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCSTPHSA
FSMVEEDLQQNLESESDLREIHGSQDCKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPK
AFNWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTF
ATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTT
SSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGTNRHPA
GLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASPPVKGLSSTEQSNKCQSPLLTHPQILPA
TQDILKALSKHPPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTS
GSDLESDLESDKEKCKENGKMFKDKVSPLQNLASINNKKEYSNHSVFSASVEEQTAVSGA
VNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRS
LPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTSVPSKPPATPATSQDQPLDLSM
GSRSRAGGTKLAEPRKNHVFGEKKGSNMEARSTSDGSLQHARPTPFFMDPIYRVEKRKLT
DPLEALKEKYLRPSPGFLFHPQFPLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVP
SMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRS
FSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSEL
ESTGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNMDERMNGSHFKDDKALVTSQSSDLLD
DEEVEDEVLLDEEDEDNDIPGKSGKELGTTNLDEEIPEDDYEEAGTLEMSCKTSPVRYKE
EDYKSGLSALDHIRHFTDSLKMRGMEENQYTDAELSSFSSSSLVPEELKQPLHRKSKSQA
YAMMLSLSDKDPIHPTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgcttatggcaac
taccctgaaatacctttggaagaaatgcctgatgtggatgcagatgggatagccaatgtt
ccctccctccatatccaagagccatgctctcctgccacatctagtgagtcattccctccc
aaggacggctctccttacaaagcccccatctacatccctgatgacatccccattcctgat
gaatttgaacttcgagagtcaaatatgcctggagcaggacttggaatatggaccaagagg
aagattgaaataggtgaaaagtttgggccatacatgggagagcagaggtcggacctgaaa
gattccagttacggatgggagatcttagatgagttttgcaatgtgaagttctgcatagat
gccagtcaaccagatgtaggaagctggctcaaatacatcagatttgctggctgttatgat
caacacaaccttgttgcatgccagataaatgatcagatattctaccgtgtagtcgcagac
atagctcctggggaagagctcctgctgttcatgaagagtgaagacgatccccatgagccc
atggcgcctgacatccatgaagaacggcagcaccgctgcgaggactgtgaccagctcttc
gaatccaaggctgaactagcagatcaccagaagttcccatgtagcacacctcactcagca
ttctccatggtggaagaggacttacaacaaaaccttgagagtgagagtgacctccgagag
atccatggcagccaggactgtaaggaatgtgacagagttttccccgatctgcaaagcttg
gagaagcacatgttgtcacatacggaggagagggaatacaagtgtgatcagtgtcccaag
gcatttaactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcac
tatgagtgtgaaaactgtgccaagcaggttttcacggaccctagcaaccttcagcgacac
attcggtctcaacatgtcggtgcccgggcacatgcttgcccggagtgcggtaaaacattt
gccacttcgtcaggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatc
tgtgaggtctgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatg
catgctgattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacg
tcttccttaaataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtgga
ttttttggccaaggcatttcacttcctggaaccccagctatggataaaacgtccatggtt
aatatgagtcatgccaacccgggcctggctgactattttggcaccaataggcatcctgct
ggtcttacctttccaacagctcctggattttcctttagctttcctggtctgtttccttca
ggcttgtaccacaggcctcctctgatacctgctagtcctcctgttaaaggactatcaagt
actgaacagtcaaacaaatgtcaaagtcccctcttgacacatcctcagatactgccagcc
acacaggatattttgaaggcactatctaaacacccacctgtaggggacaataagccagtg
gaactgctgcccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtca
gagagtagtgaccttgatgatgtcagtacaccaagtggcagtgacctggagacaacctcg
ggctctgatctggaaagtgaccttgaaagtgataaagagaaatgtaaagaaaatggtaaa
atgttcaaagacaaagtaagccctctgcagaatctggcttcaataaataataagaaagaa
tacagcaatcattccgttttctcagcatctgtagaggagcaaactgcggtgtcaggagct
gtgaatgattctataaaggctattgcgtctattgctgaaaaatactttggttccacagga
ctggtggggctgcaagacaaaaaagtcggagcgttaccttacccttccatgtttcccctc
ccattttttccagcattctctcaatcaatgtacccatttcctgatagagacttgaggtcg
ttacctttgaaaatggaaccccaatcaccaagtgaagtaaagaaactgcagaagggaagc
tctgagtccccttttgacctcaccactaagcgaaaggatgagaagcctttgacttcagtc
ccctcgaagcctccagcaacacctgccacaagccaagaccagcccctggatctaagtatg
ggcagtaggagtagagcaggtgggacaaagctggctgagcctcggaaaaaccatgtattt
ggggaaaagaaaggaagcaacatggaagcaagatcaacttcagatggctccttgcagcat
gcgagacctactcccttcttcatggaccccatttatagagtagagaaaagaaagctcacc
gacccacttgaagctttgaaagaaaaatacttgagaccttctccaggcttcttatttcac
ccacaattcccactacctgaccagagaacgtggatgtcagctattgagaacatggcagaa
aagctagagagcttcagcgccctgaagcctgaggccagtgagctccttcagtccgtgccc
tcgatgttcagcttcagagcacctcctaataccctgcctgagaacctgctgcggaagggg
aaagaacgctacacctgcagatactgtggcaagattttcccaaggtctgcgaacctgacc
cgccacttgagaacccacacaggggagcagccgtacagatgcaaatactgtgatagatca
ttcagcatttcctccaatctgcagcgacatgtccgcaacatccacaacaaggagaaacca
tttaagtgtcacttatgtgatagatgttttggtcaacaaaccaatcttgacagacaccta
aagaaacatgagaatggaaacatgtctggtacagcaacatcttcacctcattcagaacta
gaaagcacaggtgcaatcctggatgacaaagaagatgcttacttcacagagatccggaat
ttcattggaaatagcaaccatggtagtcagtctcctcggaacatggatgagaggatgaat
ggtagtcacttcaaggatgacaaggctttggtaaccagccagagttctgatttactggat
gatgaagaagtagaagatgaagtgctgttggatgaggaggatgaagacaatgacattcct
ggaaaatctggaaaggagctggggacaactaatttagatgaagaaatcccagaggatgac
tatgaggaagcaggcaccctggagatgagttgtaagacatccccggtgaggtataaagag
gaagactataaatctggcctttctgctctagatcacataaggcacttcacagacagcctc
aaaatgaggggaatggaggagaatcaatacactgacgctgagctgtcttcctttagttct
tcttctcttgtgccagaggagcttaaacagccgttacacagaaagtccaagtcacaggca
tatgctatgatgttgtcactgtcagacaaggatccaattcatcccacctcccacagttcc
tccaacgtgtggcacagcatggcaagggctgcagcagaatccagtgccatccagtccata
agccatgtatga

DBGET integrated database retrieval system