KEGG   Cricetulus griseus (Chinese hamster): 100768998
Entry
100768998         CDS       T02813                                 

Gene name
Adcy4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00230  Purine metabolism
cge01100  Metabolic pathways
cge01522  Endocrine resistance
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04611  Platelet activation
cge04713  Circadian entrainment
cge04714  Thermogenesis
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04727  GABAergic synapse
cge04742  Taste transduction
cge04750  Inflammatory mediator regulation of TRP channels
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04918  Thyroid hormone synthesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge04925  Aldosterone synthesis and secretion
cge04926  Relaxin signaling pathway
cge04927  Cortisol synthesis and secretion
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04970  Salivary secretion
cge04971  Gastric acid secretion
cge04972  Pancreatic secretion
cge04976  Bile secretion
cge05032  Morphine addiction
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100768998 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100768998 (Adcy4)
   04371 Apelin signaling pathway
    100768998 (Adcy4)
   04020 Calcium signaling pathway
    100768998 (Adcy4)
   04072 Phospholipase D signaling pathway
    100768998 (Adcy4)
   04024 cAMP signaling pathway
    100768998 (Adcy4)
   04022 cGMP-PKG signaling pathway
    100768998 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100768998 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100768998 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100768998 (Adcy4)
   04062 Chemokine signaling pathway
    100768998 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    100768998 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    100768998 (Adcy4)
   04912 GnRH signaling pathway
    100768998 (Adcy4)
   04913 Ovarian steroidogenesis
    100768998 (Adcy4)
   04915 Estrogen signaling pathway
    100768998 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    100768998 (Adcy4)
   04921 Oxytocin signaling pathway
    100768998 (Adcy4)
   04926 Relaxin signaling pathway
    100768998 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    100768998 (Adcy4)
   04918 Thyroid hormone synthesis
    100768998 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    100768998 (Adcy4)
   04916 Melanogenesis
    100768998 (Adcy4)
   04925 Aldosterone synthesis and secretion
    100768998 (Adcy4)
   04927 Cortisol synthesis and secretion
    100768998 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100768998 (Adcy4)
   04270 Vascular smooth muscle contraction
    100768998 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    100768998 (Adcy4)
   04971 Gastric acid secretion
    100768998 (Adcy4)
   04972 Pancreatic secretion
    100768998 (Adcy4)
   04976 Bile secretion
    100768998 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100768998 (Adcy4)
   04727 GABAergic synapse
    100768998 (Adcy4)
   04725 Cholinergic synapse
    100768998 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    100768998 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    100768998 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    100768998 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    100768998 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    100768998 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100768998 (Adcy4)
   04714 Thermogenesis
    100768998 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768998 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    100768998 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100768998 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100768998 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100768998 (Adcy4)
   05163 Human cytomegalovirus infection
    100768998 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100768998 (Adcy4)
Enzymes [BR:cge01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100768998 (Adcy4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 100768998
NCBI-ProteinID: XP_027246330
Position
1
AA seq 1072 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLIIVLCTLVALPAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQQLQRWTRPLSGLIWAALLALGHGFLFTGGVVSAWDQV
SFFLFIIFTVYSMLPLGMRDAAIAGLISSLSHLLVLGLYLGWQPDPQRALLPQLAANAVL
FLCGNVVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAVQVSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKDHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRVATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
VYAVERADMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAKGLLSSLEGHKMRPSLLMTR
YLESWGAAKPFAHLSHVDSFVCTSTPLPEKAFSPQWSLDRSRTPRGLDEELDTGDAKFFQ
VIEQLNSQKQWKQSKDFNLLTLYFRDNEMEKQYRLSALPAFKYYAACTFLVFLSNFAIQM
LVTNRPPALAITYSITFLLFLLLLFVCFSEHLTKCVQKGPKLLHWLPALSVLVTTRPGLR
VALGTATILLVFTMAIASLLFLPVSSDCLFLASNASSMAFNASWELPGSLPLISIPYSMH
CCVLGFLSCSVFLHMSFELKLLLLLLWLVASCSLFLHSHALLSDCLIAHLYPSPLDSRPG
VLKEPKLMGAIYFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLE
NVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLN
EIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDADRSCSHLGTMVEFA
VALGSKLDIINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVL
GKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGSPSAP
NT seq 3219 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgccccccagcgaagatctcttctacgagacctac
tacagcctgagccaacagtacccactgctactactgcttctgatcatcgtgctctgcacg
ctcgtggcactgccagccgtcgcctgggccagcggcagggagctgacctcagacccaagc
ttcctgacaaccgtgctgtgtgctttgggtggcttctctctgctgttgggactggcttcc
cgggagcagcaactgcagcgctggacacgacctctttccggcctcatatgggctgcactg
ctggctctaggccatggatttctgttcactgggggtgtggtgagcgcctgggaccaggtg
tcatttttcctcttcatcatcttcactgtgtattccatgttgcccttggggatgcgggat
gctgctattgcaggcctcatctcatcactctcgcatctgctggtccttggactctacctt
gggtggcagcctgatccacagagggctctgctaccacagttggcagcaaacgcggtcttg
ttcctgtgtgggaatgtggtgggagcataccacaaggccttgatggagagagcattgcgc
gccacattccgggaggctctcagctctctgcactcacgccggaggctggacactgagaaa
aagcatcaggagcacctccttttgtccatccttcctgcctacctggcccgagagatgaaa
gccgagatcatggcacggctgcaggctgtgcaggtgtcacggccggagaacacgaacaac
tttcacagcctgtatgtcaagaggcaccaaggagtcagtgtgctgtatgctgacatcgtg
ggcttcactcggctggccagtgagtgttcccctaaagaactggtgctcatgctcaatgag
ctcttcggcaagttcgaccagattgccaaggaccacgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctcggggctgccactctcactgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgtcgggccatcaggaaacttcgggtagccactggt
gtggacatcaacatgcgtgtgggtgtgcactcgggcagtgtgctctgtggagtcatcggg
cttcagaagtggcagtatgatgtctggtcccatgatgtcacattggctaaccacatggaa
gctggtggcgtgccaggacgagtacacatcacaggggctactctggccctgttagcaggg
gtttatgctgtggagagagcagacatggaacaccgagacccataccttcgggagctaggc
gaacctacgtacctggtcatcgatccccgggctgaggaggaagatgagaagggcactgct
aaaggattactgtcttctttggaggggcacaagatgcgtccatcactactgatgactcgt
tatctggagtcttggggtgcagccaaacctttcgcccacttaagccacgttgacagtttt
gtatgcacctccactccactcccggaaaaggccttcagcccccagtggagcctggaccgg
agtcgcaccccacggggactagatgaagaactggacactggggatgccaagttcttccag
gtcatcgagcaactcaattctcaaaaacagtggaagcagtcgaaggacttcaacctcctg
acactgtacttcagagacaacgagatggagaaacagtatcggctctctgcactccccgcc
ttcaaatactatgcagcctgcaccttcctggtttttctgtccaacttcgctatccaaatg
ctggtgacaaacaggcccccagctctggccatcacctatagcatcaccttcctcctcttc
cttctcctcctcttcgtctgcttctcagaacacttgacgaagtgtgtccagaaaggtccc
aaactgttgcactggctgcctgcactgtctgtcctggtgactacacggccaggacttcga
gtagccctgggcactgccactatcctcctggtgttcaccatggccatcgccagcctgctc
ttcttgccagtgtcatcagactgccttttcctggcttccaatgcctcgtccatggctttc
aatgcttcctgggagctgccaggatccctgcctctcatcagtatcccatactccatgcat
tgctgcgtgctgggtttcctctcctgttccgtttttctgcacatgagctttgaactgaaa
ctcctgctgcttctgctgtggctggtggcatcctgttccctgtttctgcactcacatgcc
ttgctgtccgactgcctcatcgcccacctctatccaagtcctttggactccaggccaggg
gtgctgaaggaacccaaactgatgggtgccatctacttcttcatcttcttcttcacgctc
cttgtcctggctcggcagaatgagtattactgccgcctggacttcctgtggaagaagaag
ctgaggcaggagcgagaggagactgagacgatggagaacctgactcggctcctcctggag
aatgtactcccagcacatgtggccccccagttcattggccagaaccggcgcaatgaggac
ctctaccaccagtcctacgaatgtgtgtgtgtcctctttgcatcggtgccggactttaag
gaattctactctgaatctaacatcaaccatgaaggactggagtgtctgcggctgctcaat
gagataattgctgattttgacgagctgctctccaagccgaagttcagtggagtagagaaa
atcaaaactattggcagcacctacatggcagccacaggcttgaatgccacctctggacaa
gacacacagcaggatgccgatcgaagctgcagccatctgggcaccatggtggaatttgca
gtggccctgggatctaagctggatatcatcaataagcactcattcaacaacttccgcctg
cgtgtggggttgaaccacggaccagtcgtagcaggagtgattggggcacagaagccacaa
tatgacatctgggggaacacagtgaatgtggccagccgcatggagagtacaggagttctt
ggcaagatccaagtgactgaggagacagctagagccctgcaatccctgggttatacatgc
tacagccggggtgtcatcaaggtcaaaggcaaaggacaactttgtacctacttcttgaac
acagacctgacaagaaccggatctccctcagccccctag

DBGET integrated database retrieval system