KEGG   Cricetulus griseus (Chinese hamster): 100769391Help
Entry
100769391         CDS       T02813                                 

Gene name
Abhd6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:cge00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100769391 (Abhd6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cge01002]
    100769391 (Abhd6)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100769391 (Abhd6)
Peptidases [BR:cge01002]
 Serine Peptidases
  Family S33
   100769391 (Abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr FSH1 DUF1057 Lipase BAAT_C DLH DUF2048
Motif
Other DBs
NCBI-GeneID: 100769391
NCBI-ProteinID: XP_007611626
UniProt: A0A061IL50
Position
Un
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRVHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDICSLCLVCPAGLQYST
DNQFVQRLKELQDSAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRRLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADILAKSIANCQVEL
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNNKKLN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgatgtagttaacatgtttgtgattgcgggtggaaccctggccattccaatc
ctggcattcgttgcttcttttctcctgtggccttcagcactgataaggatctattattgg
tactggcggaggacgctgggtatgcaagtccgctatgcacaccacgaggactatcagttc
tgttactccttccggggcaggccaggacacaaaccatccatcctcatgctccatggtttc
tcagcacacaaggacatgtggctcagcgtggtcaagttccttccaaagaacctgcatttg
gtctgcgtggacatgcctggtcatgaaggtaccacccgctcctccctggatgacctgtcc
atagatgggcaagttaagagggtacaccagtttgtagaatgccttaagctgaacaaaaag
ccctttcaccttataggcacctccatgggtggccacgtggctggagtatacgccgcttac
tacccatctgatatctgcagcctgtgtctggtgtgccctgctggcctgcagtattcaact
gacaatcagtttgtgcaacggctcaaagagctgcaggattccgctgccattcagaaaatc
cccttgatcccatcgaccccggaagagatgagtgagatgctccagctctgctcctatgtc
cgattcaaggtgccccagcagatccttcaaggcctcgttgatgttcgcatccctcataac
agtttctaccggagattgtttttggaaattgtcagtgagaaatccagatactctctccat
cagaacatggacaagatcaaggtcccaacacagatcatttgggggaaacaagaccaggtg
cttgatgtgtctggggcagatattttggccaagtctattgctaactgccaggtagagctt
ctggaaaattgtggccactcagtggtgatggagagaccaagaaagacagccaagctcatt
gtcgactttttagcttctgtgcataacacagacaacaacaagaagctgaactga

DBGET integrated database retrieval system