KEGG   Cricetulus griseus (Chinese hamster): 100769392Help
Entry
100769392         CDS       T02813                                 

Gene name
Gria1
Definition
(RefSeq) glutamate receptor 1 isoform X2
  KO
K05197  glutamate receptor 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04024  cAMP signaling pathway
cge04080  Neuroactive ligand-receptor interaction
cge04713  Circadian entrainment
cge04720  Long-term potentiation
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04728  Dopaminergic synapse
cge04730  Long-term depression
cge05014  Amyotrophic lateral sclerosis (ALS)
cge05031  Amphetamine addiction
cge05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100769392 (Gria1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100769392 (Gria1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100769392 (Gria1)
   04728 Dopaminergic synapse
    100769392 (Gria1)
   04720 Long-term potentiation
    100769392 (Gria1)
   04730 Long-term depression
    100769392 (Gria1)
   04723 Retrograde endocannabinoid signaling
    100769392 (Gria1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100769392 (Gria1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100769392 (Gria1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100769392 (Gria1)
   05033 Nicotine addiction
    100769392 (Gria1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cge04040]
    100769392 (Gria1)
Ion channels [BR:cge04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100769392 (Gria1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 100769392
NCBI-ProteinID: XP_027283248
Position
7
AA seq 907 aa AA seqDB search
MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLTRNSGAGASGGGGSGENGRVVSQDFAKSMQSIPCMSHSSGM
PLGATGL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacatctttgcctttttctgcaccggttttctaggtgcggttgtgggtgccaat
ttccccaacaatatccagatagggggattatttccaaaccaacaatcgcaggaacatgca
gcttttaggtttgctttgtcacaactcacagagccccccaagctgcttccccagattgat
attgtgaacatcagtgacagtttcgagatgacttaccgattctgttcccagttctccaaa
ggagtctatgccatctttgggttttatgaacgaaggactgtcaacatgctgacctccttc
tgtggggccctccatgtgtgcttcattactccaagttttcccgttgacacatccaatcag
ttcgtccttcagctgcgaccagaactacaggaagctctcattagcatcatcgaccattac
aagtggcagacctttgtctacatttatgatgctgaccggggcctgtcagtcctgcagaga
gtcctggatacagctgcagagaagaactggcaggtgacagctgtcaacatcctgacgacc
acagaggaaggataccggatgctcttccaggacctggagaagaaaaaggagaggctggtg
gtggtggactgtgaatcagaacgcctcaacgccatcctgggccagattgtgaagctggaa
aagaatggcattggttaccactacatccttgccaatctgggtttcatggacattgactta
aataagttcaaggagagtggagccaacgtgaccggtttccagttagtgaactacacagac
accatcccagccagaatcatgcagcagtggaggacgagtgacgctcgagaccacaccaga
gttgactggaaaaggccgaagtacacatctgctctcacctatgatggtgtgaaagtgatg
gccgaggccttccagagcctgcggaggcagaggattgacatatcccgcaggggaaacgct
ggggactgtctggctaacccagctgtaccctggggccaagggatcgacatccagagagcc
ctgcagcaggtacgattcgaaggtttgacgggaaacgtgcagtttaatgagaaagggcgc
cggaccaactataccctccacgtgattgaaatgaagcatgatggaattcgaaagattggt
tactggaatgaagatgataagtttgtccctgcagctactgatgctcaggctggaggggac
aactccagcgtccagaatagaacctacatcgtcactacaatcctagaagatccttatgtg
atgcttaaaaagaatgccaaccagttcgagggcaatgaccgctatgagggctactgtgtg
gagctggctgcggagatcgccaagcatgtaggctactcctaccgactcgagatagtcagc
gatggcaaatatggagcccgggatcccgacacaaaggcctggaatggcatggtgggagag
ctggtctatggaagagcagatgtggcagttgcccccttgaccatcaccttggtccgggag
gaggtcattgacttctccaagccattcatgagtttgggaatctccatcatgatcaagaag
ccacagaagtccaagcctggtgtcttctcctttcttgaccctttggcctatgagatctgg
atgtgtattgtgtttgcctacatcggagtaagcgtcgtcctcttcctggtcagccgtttc
agcccctatgaatggcacagtgaagagtttgaagagggacgagatcagacaaccagtgac
cagtcgaatgagtttggcatattcaacagcctatggttctctctgggggccttcatgcag
caaggatgtgacatttctcccaggtccctgtctggacgcattgtcggcggcgtctggtgg
ttcttcactttgatcatcatctcctcatacacagccaacctggctgccttcctgactgtg
gagaggatggtgtctcccatcgagagtgcagaggacctggcaaagcagacggaaattgct
tatgggacattggaagcaggctccactaaggagttcttcaggaggtctaaaattgctgta
tttgagaagatgtggacatacatgaagtctgcagaaccgtctgtgtttgttcggaccaca
gaggagggtatgatcagagtgagaaaatctaaaggcaaatatgcctacctcctggagtct
accatgaatgagtacattgagcagcgcaagccttgtgacaccatgaaagtaggaggtaac
ttggattccaagggctacggcattgcaacacccaaggggtccgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaaaacaagtgct
ctgagcctcagcaatgtggcaggcgtattctacatcctgattggagggctgggactggcc
atgctggttgccttaatcgagttctgctacaaatcacgtagcgagtcgaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacatcaaccctcacc
agaaacagtggggcaggagccagtggaggaggcggcagtggagagaatggccgggtggtc
agccaggacttcgccaagtccatgcaatccattccctgcatgagtcacagttcagggatg
cccttgggagccacaggattgtaa

DBGET integrated database retrieval system