KEGG   Cricetulus griseus (Chinese hamster): 100770010
Entry
100770010         CDS       T02813                                 

Gene name
Adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cge01002]
    100770010 (Adamts13)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100770010 (Adamts13)
Peptidases and inhibitors [BR:cge01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100770010 (Adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_CCN TSP1_spondin Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 100770010
NCBI-ProteinID: XP_035302827
Position
6
AA seq 1423 aa
MSELCLWVTCQPFHAASIRGVLTGAFFILSCWGLSDFQKSFLQDLEPKKVTTYFGNNAAA
LTGHPSSHLQRLRWRRTSGDILHLELLVAVGPDVYQVHQEDTERYVLTNLNIGSKLLRDP
SLGAQFQVHLVKLIILSDSESIPNITTNITSSLMSVCEWSHTINPHDDRDPSHADLILYI
TRFDLELPDGNKQVRGVTQLGGACSLSWSCLITEDTGFDLGVTIAHEIGHSFGLDHDGTP
GSGSTCEASGHVMASDGAVPTGGSLEWSTCSQRQLQHLLSTGQMHCFWDPPGTQPALSWH
QLMAQPGLYYSADDQCRVAFGSGAVACTFSREGLDVCQALSCHTDPLDQSSCSRLLVPLL
DGTECGVEKWCSKARCQSLAELSPVAAVHGHWSSWGSDSPCSRSCGGGVIIRRRWCNNPR
PAFGGRTCVGEDLQAKMCNTQACEKTQLEFMTEQCAQTDSQPLHLPQGGASFYHWDAAVQ
YSQGDTLCRHMCWAVGESFIVSRGDSFLDGTRCVPTGPREDGTLSLCVLGSCRTFGCDGR
MDSQKVWDVCQVCGGDNSTCSSQNGSFTGGRAREYVTFLTVTPNMTSVHIVNRRPLFTHL
AVRIQGHYIVAGKTSISPSIMYPSLLEDCRVEYRVTLTEDRLPHLEEIHIRGPVQEDMEI
QVYRRYRADYGDLTHPDITFTYFQLKQQAAWVWTAMRGPCSVSCGAGLRWVTYSCQDQAQ
NKEVNSALCQGSPQPPAWQEPCTPAPCPPYWTTGDFSPCSVSCGGGLRERLVHCVEAQDG
FLRTLPPARCKAVAQQPAAEVENCNSQPCPTRPEASDPSSCMTTCEDLASRNVTCVPKVG
DLEDPATAGPCLTDKMPPTLEPCLRTTCSPGWGQLDTMSLGEEAPSPVDSDKPGAQAAHK
WTPVTGLCSTSCGRGLMELHFLCMDSVLKMPVQEELCDLASKPSSRWEVCRAGPCPARWE
TQVLAPCPVTCGGGTVPLAVHCMQMGHGRPVFLPHSKCWPVPRPFPFKDCSPEPCPARWK
ILSLGPCSASCGLGTATRMVACMQLDRGNDSEVDGTFCKALVRPRASVPCLIADCAYRWH
ISTWTECSVSCGDGIQRRHDTCLGPQAQVPVPASFCQHLPKPVTVRGCWAGPCAGQEIPS
SLAQKEAAIPSQTQAAVTVASLEWSQPPAQARTLFPASLSPGIQESLEESGACGRQYLEP
TGTIDMRGQGQVDCVVAIGRPLGEVVTLQILQSTLECSAGELLLLWGRFTWRKTCWKMSG
MTFSTKTNTLVVRQHRVQSGGGVLLQYWSRPAPGTFYRECDRQLFGPRGEIVSPPRSPAW
RNARSCRVFISVAPQARIAIRALASGVGTASKGTNANYVSIRDIHSLRTTTFWGQQTLYW
ESEGSEAELEFSPGFLEAHASFQGLYWTIPLRTPEQDNSLVLS
NT seq 4272 nt   +upstreamnt  +downstreamnt
atgagcgagctttgcctatgggtgacatgccagccttttcatgctgccagtatcagagga
gtcctcacaggtgcctttttcattctgagctgctgggggctctctgatttccagaagagt
tttcttcaagatctggaacccaagaaggtaaccacttactttggcaacaatgctgctgca
ctcacaggccacccttcctctcacctccagagactgagatggagaaggacttcgggggac
attctgcacctggagctactggtcgctgtgggtcctgatgtctaccaggttcaccaggag
gacacagaacgctacgtgctcaccaaccttaatatcgggtcaaaactgttgagggaccca
tccctgggggctcagttccaagtgcacctggtgaaactgattattctctctgactcagag
agtattccaaatatcacgaccaacatcacgtcatcactgatgagtgtctgtgagtggagc
cacacaatcaacccccatgacgacagggatccaagtcatgctgacctgattctttatata
accaggtttgacctggagttgcctgatggtaacaagcaggttcggggggtcacccagctg
ggaggtgcctgctccctgtcctggagctgcctcatcactgaggacactggattcgaccta
ggggtcaccattgctcatgagattggacacagcttcggcctggaccatgatggtactcca
ggcagtggcagcacctgtgaggccagtggccatgtgatggcatctgatggtgcagtgcct
acaggagggtccctggagtggtccacctgcagccaaaggcaactgcagcacctgctcagc
acagggcaaatgcactgcttctgggacccacctgggacgcagccagcactttcatggcac
cagctgatggcacagcctggcctctactacagtgcggacgatcagtgccgtgtggctttc
ggctctggggctgtcgcctgcaccttctccagggagggtctggatgtatgccaggctcta
tcctgccacacagaccctctggaccaaagcagctgcagccgcctccttgttcctctcctg
gatgggacagaatgtggtgtggaaaagtggtgctccaaggctcgctgccaatccctagct
gagctaagccctgtggcagcagtccatggacactggtctagctggggctccgatagtcct
tgctcccgatcctgtggaggaggtgtgatcatcaggagacggtggtgcaacaatcccagg
cctgcctttgggggacgtacatgtgtgggtgaggacctccaggctaagatgtgcaacaca
caggcttgtgagaagactcagctggagttcatgactgagcagtgtgcccagactgacagc
cagccactgcaccttccccaaggtggtgcctccttttaccactgggatgccgctgtgcag
tacagtcaaggggacactctgtgcagacacatgtgctgggctgttggagagagcttcatt
gtgagccgtggagacagcttcctagatgggacccgctgtgtgccaactgggcctcgggaa
gatggaaccctgagcctgtgtgtgttgggcagctgcaggacctttggctgtgatggcaga
atggactcccagaaggtttgggatgtgtgccaggtgtgcggaggagacaacagcacgtgc
agttcacagaatggctctttcacgggtgggagagccagagaatatgtcacgttcctgaca
gttactcccaacatgaccagcgtgcacatcgtgaaccgcaggcctctcttcacacacttg
gcggtgaggatccaaggacactacattgtggcagggaagaccagcatctcacctagcatc
atgtacccttcccttctggaggactgccgtgtggagtacagagtgaccctcactgaggac
cggctgccccacttagaggagattcacatccgaggacctgtccaggaagacatggagatc
caggtgtacagacgatatagagcagattatggggatcttacacacccagacatcaccttt
acctacttccaactgaagcagcaggctgcttgggtatggactgctatgcgtggaccctgc
tcagtgagctgtggggcagggctgcgctgggtgacctacagctgccaggatcaagctcaa
aacaaggaagtgaacagtgccctgtgccaagggagcccacagccacctgcatggcaagag
ccttgtacccctgccccctgccctccatactggacaactggagacttcagcccatgtagt
gtgtcctgtggtgggggtcttcgggaacgactagtacactgtgtggaggcccaagatggt
ttcttaaggacactgccaccagcccggtgcaaagcagtagcccagcagccagcagcagag
gtggaaaattgcaactcccagccctgtcccaccagaccagaggcgtcagaccctagctct
tgcatgaccacctgtgaagatctggcgtcaagaaatgtgacatgtgtgcccaaggtgggt
gacctggaggacccagcaactgcgggtccttgcctcacagataagatgccacctacgctg
gagccctgtctgaggactacatgctctccaggctggggtcagctggacaccatgtctctg
ggagaggaggctccaagccctgtggacagtgacaagccaggggctcaggctgcacacaag
tggactcctgtgacaggactgtgctccacctcttgtggacgaggtctgatggagctgcat
ttcctgtgcatggattctgtcctcaagatgcctgtccaggaagagctatgtgacttggcc
agcaagccctccagccggtgggaggtctgtcgggctggcccctgccctgctcggtgggag
actcaagtcttggcaccatgcccagtgacctgtggagggggaactgtgccactggctgtt
cattgtatgcaaatgggccacggccgacctgtgtttctacctcactccaagtgctggcca
gtgcctaggccattccccttcaaggactgcagccctgagccctgtcctgcaagatggaaa
atcctgtcccttggcccatgctcagccagctgtggccttgggactgccacccgaatggtg
gcctgcatgcagcttgaccgaggcaatgacagtgaagtggacggaactttctgtaaggct
ctggtgcggcctcgggctagtgtcccctgcctcattgctgactgtgcctaccggtggcac
atcagcacatggacagagtgctctgtttcctgtggggatggcatccagcgccggcatgac
acctgccttggaccccaggcccaagtgcctgtgccagccagcttctgccagcacctaccc
aagccagtgacagtgaggggctgctgggctggaccctgtgcagggcaggagatccccagc
tcactggcccagaaggaagctgctattcccagccagacccaggctgctgttactgttgct
tctctggagtggtcccagcccccagcccaagcccgcaccctcttcccagcctccctatct
ccggggatccaggaaagcctggaggagtctggtgcctgcggaaggcaatacctggagccc
acaggaacaattgacatgcgaggtcaagggcaggtagactgcgtggtggccattgggcgg
cctctaggtgaagtggtgaccctccaaatcctccagagcaccctcgagtgtagcgcaggg
gagctgttgctgctttggggtagattcacatggaggaagacatgctggaagatgtctggc
atgactttcagcaccaaaaccaacacgttggtggtgaggcagcatcgtgtgcagtcagga
ggaggagtactgctacagtactggagccggcctgctccagggaccttctacagagaatgt
gacaggcagctctttggacctcggggtgaaattgtgagtcccccacggagcccagcctgg
aggaatgcgaggagctgccgggttttcatcagtgtggctccacaggcccgcattgccatc
cgtgctctggccagtggtgtgggcactgcctctaaggggaccaatgctaactatgtctcg
atcagggatatccacagtctgaggaccacaacattttgggggcagcagacgctctactgg
gagtcggaaggcagcgaggctgaactggaatttagccctggtttcctggaggcgcatgct
agcttccagggtctgtactggaccatcccactgaggacaccggaacaggacaacagcctg
gttctgtcctag

DBGET integrated database retrieval system