KEGG   Cricetulus griseus (Chinese hamster): 100770374
Entry
100770374         CDS       T02813                                 

Gene name
Bola2b
Definition
(RefSeq) bolA-like protein 2
Organism
cge  Cricetulus griseus (Chinese hamster)
SSDB
Motif
Pfam: BolA
Other DBs
NCBI-GeneID: 100770374
NCBI-ProteinID: XP_027260448
UniProt: G3I4G8
Position
3
AA seq 86 aa
MELSADYLREKLQRDLEADHVVVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECL
AEELPHIHAFEQKTLTPEQWTRELQK
NT seq 261 nt   +upstreamnt  +downstreamnt
atggaactcagcgccgactacctccgcgagaagctgcagcgggacctggaggcagaccat
gtggtggtggaggacacgactctcaaccgttgcgcgaccagcttccgagtcctggtggtg
tcggctaagttcgagggaaagccactgctccagagacaccggctggtgaatgagtgctta
gcagaagagctcccgcacatccatgcttttgagcagaaaactctgaccccagagcagtgg
acccgagagctgcagaaatga

DBGET integrated database retrieval system