KEGG   Cricetulus griseus (Chinese hamster): 100770390
Entry
100770390         CDS       T02813                                 

Gene name
Irf8
Definition
(RefSeq) interferon regulatory factor 8
  KO
K10155  interferon regulatory factor 8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge05133  Pertussis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    100770390 (Irf8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100770390 (Irf8)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100770390 (Irf8)
SSDB
Motif
Pfam: IRF-3 IRF MH2
Other DBs
NCBI-GeneID: 100770390
NCBI-ProteinID: XP_035297357
UniProt: G3GRW0
Position
3
AA seq 424 aa
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKSMFRIPWKHAGKQDYNQEVDASIFKAW
AVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKC
KLGVVPAGCMSDVTEMECGRSEIDELIKEPSVDEYMGLTKRSPSPPEAGRSQVLPDWWVQ
QPSAGLPLVTGYAAYDTHHSAFSQMLISFYYGGKPVGQATTTCPDGCRLSLSQPGLPKLY
GPDGLEPVCFPTADTIPIERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGN
AVVCKGRPNKLERDEVVQVFDTNQFFRELQQFYATQSRLPDSRVVLCFGEEFPDTAPLRS
KLILVQVEQLYARQLMEEAGKSCGAGPLMPALEEPPLDHTLRMFPDICASHQRPFFRENQ
QITV
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgtgtgaccggaatggcgggcgtcggctccggcagtggctgattgagcagattgacagc
agtatgtacccggggctgatatgggaaaatgacgagaagagtatgttccgtatcccttgg
aagcatgctggcaagcaggattacaatcaggaagtggatgcttccatcttcaaggcctgg
gcagtttttaaagggaagtttaaagagggggacaaagctgagccagccacgtggaagacg
aggttacgctgtgctttgaacaagagcccagattttgaggaagtgactgatcgatcccag
ctggacatttccgagccatataaagtttacagaattgtccccgaggaagagcaaaaatgc
aagctgggcgtggtgcctgcaggctgtatgagcgatgtcacggagatggagtgtggtcgc
tctgagattgatgagctgatcaaggagccttctgtggatgaatacatgggtctgaccaaa
aggagtccatccccaccagaggccggcaggagccaggtccttcctgactggtgggtccag
cagcctagtgcgggtctgccactggtgactggatacgctgcctatgacacacaccattca
gccttctcccagatgctgatcagcttctactatgggggcaagcctgtgggccaggccacc
actacctgccccgatggctgccgcctatccctgagccagccggggcttcccaaactgtat
gggcccgatggcctggagccagtgtgcttcccaacagctgacaccatccccatcgagcgg
cagaggcaggtgacccggaagttgtttggacacctggagcgtggcgtgctcctgcacagc
aaccgcaagggtgtgttcgtgaagcggctgtgccagggccgtgtgttctgcagtggcaat
gcggtggtgtgcaagggcaggcccaacaagctggagcgggatgaggtggtgcaggtcttt
gacaccaaccagttcttcagagaactgcagcaattctacgccacccagagtcgccttcct
gatagcagggtggtgctgtgctttggggaggagtttccggacacagcgcccttgcggtcc
aagctcattctggtgcaggtggagcagctgtatgccaggcagctgatggaggaagcaggc
aagagctgtggtgctggtcccctgatgccagccctggaggagcccccactagaccatacc
ttgcggatgtttccagatatctgtgcctcacaccagagaccctttttcagagaaaaccaa
cagatcaccgtctaa

DBGET integrated database retrieval system