KEGG   Cricetulus griseus (Chinese hamster): 100770407Help
Entry
100770407         CDS       T02813                                 

Gene name
Cpm
Definition
(RefSeq) carboxypeptidase M
  KO
K01296  carboxypeptidase M [EC:3.4.17.12]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cge01002]
    100770407 (Cpm)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100770407 (Cpm)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.12  carboxypeptidase M
     100770407 (Cpm)
Peptidases [BR:cge01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100770407 (Cpm)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Enzymes
  100770407 (Cpm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 CarboxypepD_reg AstE_AspA Dioxygenase_C
Motif
Other DBs
NCBI-GeneID: 100770407
NCBI-ProteinID: XP_027248141
Position
1
AA seq 443 aa AA seqDB search
MDLARLWLGLLLPLVAALDFRYHHQEGMEAFLKSVAQNYSSITHLHCIGKSVRGRNLWVL
VVGKSPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTNHGKDAEITQLINSTRIH
IMPSMNPDGFEAVKKPDCYYSNGRENYNNYDLNRNFPDAFENNNVTQQPETLAVMKWLKT
ETFVLSANLHGGALVASYPFDNGVQATGTLLSRSLTPDDDVFQHLAYTYASRNPNMTKGD
QCKNKRNFPNGITNGYSWYPLQGGMQDYNYIWAQCFELTLELSCCKYPREEKLPVFWNDN
RASLIEYIRQVHLGVKGQVFDQSGNPLPNVIVEVQDRKHICPYRTNKLGEYYLLLLPGSY
VINVTVPGHDPHLTKLTIPRNSQTLGALKKDFHLPFRVQLDSILVSDPSCPMVPLYKLRP
NHTAATKPTLYVFLLTLLHIFFK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgcgcgcctgtggctggggcttctgctgcccctagtagccgccctggatttc
cgataccaccaccaggaagggatggaagcgttcctaaagagcgttgcccagaactacagt
tccatcacgcacttacactgcatcgggaaatctgtgagaggtagaaacctgtgggttctt
gttgtggggaagtctccaaaggaacaccgaattgggattccagaattcaaatacgtggct
aatatgcatggagatgagaccgtggggcgagaattgctgctccacctcatcgactacctg
gtgaccaatcacgggaaagatgccgaaatcacacaactaatcaacagcactcggatccac
atcatgccttccatgaacccagatggatttgaagccgtcaagaagcccgactgttattac
agtaacggaagggaaaattacaacaattatgacctgaacagaaactttcctgatgccttc
gaaaataataacgtgacacagcagcctgagaccctggcagtcatgaagtggctgaaaacc
gagacatttgtcctctctgccaatctccacgggggtgccctggtggccagctaccccttc
gataatggcgtgcaagccacggggacactgttgtcccgaagcctaaccccagatgacgat
gtttttcaacacctcgcatatacctacgcttcccggaaccccaatatgacaaaaggagat
cagtgcaaaaacaaaaggaacttccccaatggaattactaatgggtactcctggtatcca
ctgcaaggtggaatgcaagattacaactacatctgggcccagtgttttgaacttacattg
gagctgtcatgctgtaaataccctcgagaagaaaagctaccagtgttttggaatgacaac
agagcctctttgattgaatatataagacaggtgcacctaggtgtaaaaggtcaagtgttt
gaccagagtggaaatccattgccgaatgtaattgtggaagtccaagacagaaaacacatc
tgcccatatcgaaccaacaaacttggagagtactacctgcttcttttgccagggtcctac
gtgatcaatgttacagtccctgggcatgacccgcacctcacaaagctgactatcccaagg
aattcccagaccctcggtgctcttaaaaaggatttccacctcccgtttcgagtgcaactg
gattccatcctcgtatcagatccttcgtgcccaatggttcctctgtataaactaaggcca
aaccacacagctgcaacaaagcctactttgtatgtattcctcttgactcttttgcacata
tttttcaaataa

DBGET integrated database retrieval system