KEGG   Cricetulus griseus (Chinese hamster): 100771756Help
Entry
100771756         CDS       T02813                                 

Gene name
Pla2g4b
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00564  Glycerophospholipid metabolism
cge00565  Ether lipid metabolism
cge00590  Arachidonic acid metabolism
cge00591  Linoleic acid metabolism
cge00592  alpha-Linolenic acid metabolism
cge01100  Metabolic pathways
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04072  Phospholipase D signaling pathway
cge04217  Necroptosis
cge04270  Vascular smooth muscle contraction
cge04370  VEGF signaling pathway
cge04611  Platelet activation
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04724  Glutamatergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04750  Inflammatory mediator regulation of TRP channels
cge04912  GnRH signaling pathway
cge04913  Ovarian steroidogenesis
cge04921  Oxytocin signaling pathway
cge05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100771756 (Pla2g4b)
   00565 Ether lipid metabolism
    100771756 (Pla2g4b)
   00590 Arachidonic acid metabolism
    100771756 (Pla2g4b)
   00591 Linoleic acid metabolism
    100771756 (Pla2g4b)
   00592 alpha-Linolenic acid metabolism
    100771756 (Pla2g4b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100771756 (Pla2g4b)
   04010 MAPK signaling pathway
    100771756 (Pla2g4b)
   04370 VEGF signaling pathway
    100771756 (Pla2g4b)
   04072 Phospholipase D signaling pathway
    100771756 (Pla2g4b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100771756 (Pla2g4b)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100771756 (Pla2g4b)
   04664 Fc epsilon RI signaling pathway
    100771756 (Pla2g4b)
   04666 Fc gamma R-mediated phagocytosis
    100771756 (Pla2g4b)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100771756 (Pla2g4b)
   04913 Ovarian steroidogenesis
    100771756 (Pla2g4b)
   04921 Oxytocin signaling pathway
    100771756 (Pla2g4b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100771756 (Pla2g4b)
  09156 Nervous system
   04724 Glutamatergic synapse
    100771756 (Pla2g4b)
   04726 Serotonergic synapse
    100771756 (Pla2g4b)
   04730 Long-term depression
    100771756 (Pla2g4b)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100771756 (Pla2g4b)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100771756 (Pla2g4b)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100771756 (Pla2g4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 100771756
NCBI-ProteinID: XP_027276690
Position
6
AA seq 802 aa AA seqDB search
TLRDCPNLPCGPVTFGPICLQAKVTGTCLLTVRVLQANGLPSKDLVTSSDCYVTLGLPTA
SSHTLQTRTVKNSRNPVWNQNFHFRIHRQLKNVVELKVFDQDLVTRDDPVLSVLFDVGTL
RAGESRRQSFSLSTQEDGHLEVEFQLQNLTDREEQLISNGILVARELSRLHVQLKKTGDP
KGSENRVQLVVAGACEGPQDASVGAGSFLFHYPTCWEQELTVHLQDDPHEQLKVPLCTLP
SSQLVRLVFPTSQEPLMRLELKKEEGPKDLAVRLGCGLCPEEQAFLSKRKRVVAAALKKA
LQLDQDLQEDEIPVIAIMATGGGIRAMTSLYGQLAGLRELGLLDCISYITGASGSTWALA
NLYEDPEWSQKDLAGPTELLKTQVTKSKLGALAPSQLWRYRQELAERTRLGHPTCFTNLW
ALINEALLHDEPHEHKLSDQREALSQGQNPLPIYCALNSKERGLTTFEFGEWCEFSPYEV
GFPKYGAFIPSELFGSEFFMGRLVKQLPESRICFLEGIWSNLFAASLQDSLYWASEPKQF
WDRWSQDRASLDKERVPHLKITEPPPTVGRIAEFFTNLLTKRPLAQATHNFMRGLHFHKD
YFHHPHFSTWKATKLDGFPNQLTPMEPHLCLLDVGYFINTSCPPLLKPTRDVDLILSLDY
NLHGAFQQLQLVSQFCQEQGIPFPPISPSPEEQRQPQECHVFCDPAQPEAPAVLHFPLVN
DSFQDHSAPGVPRALEEKAAGKVNLSSSDSPYHYTKVTYSQEDVDKLLRLTHYNICNNQE
RLREALQQAVQRRRQRKQCRPE
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
accttgagagattgtcccaacctcccctgtggccctgtcacatttggccccatctgtctg
caggcaaaggtgacagggacatgcctgctcactgtacgtgtcctccaggctaatggcttg
ccttccaaggacctagtgacatcctctgactgctatgtgactctgggcctgcccacggcc
tccagccacacgttacagacacgtacagtcaagaacagcagaaaccctgtctggaatcag
aacttccacttccggatccacaggcagctcaagaatgttgtggaactgaaagtctttgac
caggacctggtgaccagagatgaccctgtcctgtcagtgctgtttgacgtggggactctg
agagctggggagtctcggcgccagagtttctcactgagcactcaggaggatggacacctg
gaagttgaatttcagctgcagaatctgacagaccgtgaggaacagctcatcagcaatggc
atcctagtggctcgggagctctcccgtttgcatgttcagctgaagaagacaggagaccca
aaggggtcagagaacagagttcaacttgtggttgctggggcctgtgagggcccacaggat
gcctctgtgggcgccggatctttcctcttccattacccaacctgctgggagcaagagctg
actgttcatctgcaggatgacccccacgagcaactgaaggtaccactatgcacactaccc
tcctcacagttggtgagactcgtcttccctacatcccaggagccactaatgaggctggag
ctgaagaaggaagaaggaccaaaggatctggctgtgcggctgggctgtgggctctgccct
gaggagcaggccttcctaagcaagaggaagcgggtggtggctgctgccctgaaaaaggcc
ttacagctggaccaagacctgcaagaggatgagatacccgtgattgctattatggccact
ggtggtggcatccgggccatgacttctttatatggacagctggctggcctgagggagctt
ggtctcttggactgcatctcctacatcactggggcctcaggatccacctgggcattggcc
aacctctatgaggacccagaatggtctcagaaggacctggcagggcccaccgagttgcta
aagacccaggtgacaaagagcaagctgggcgcattggcccccagccagctgtggaggtac
cggcaggagctggctgagcgtacccgtctgggccacccaacctgcttcaccaacttgtgg
gccctcatcaatgaggccttgctgcatgatgagccccatgaacacaaactctcagatcaa
cgggaggctctgagtcaaggccagaaccctctgcctatctactgtgcactcaacagcaag
gagcggggcctgaccacctttgaatttggggaatggtgtgagttctctccctatgaagtt
ggctttcccaagtatggggccttcatcccctctgagctctttggctccgagttcttcatg
gggcgactggtgaagcagctccccgagtcccgcatctgcttcctggaaggtatctggagc
aacctgtttgcagccagcctccaagacagcttgtactgggcctctgaacccaaacagttc
tgggaccgctggtcccaggatcgggccagcctggacaaagaacgggtcccccatctgaag
atcacagaacccccgccaacagttgggaggatcgccgagttcttcaccaacctcctgaca
aaacggccacttgcccaggccacccacaatttcatgcgtggcctccatttccacaaggac
tatttccatcaccctcacttctccacctggaaagctaccaaactggatgggttccccaac
cagctgacgcccatggagccccacctctgcctcctggatgttggctacttcatcaatact
agctgcccaccactcctgaagccaacacgggatgtggacctcatcttgtcgctggattat
aacctccatggagcctttcagcagctgcagcttgtgagccagttctgccaggagcagggc
atccctttcccccccatctcacccagccccgaggagcagcgccaacctcaggagtgccat
gtgttctgtgaccctgcccagcccgaagccccagctgtgctgcacttccctctggttaat
gactccttccaggaccactcggcccctggggtgccacgggcattggaggagaaggcagct
gggaaggtgaacctctcttcttctgattccccataccactacacaaaagtgacctacagc
caggaggatgtggacaagttgttacgccttacacattacaatatctgcaacaaccaggaa
cggttgcgggaagccctgcagcaggctgtgcagcggcggagacagcgcaaacagtgcagg
cctgagtga

DBGET integrated database retrieval system